Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G086845-GRMZM2G026969
Species:maize
Duplication type:WGD
Function (paralog1):Fructokinase-1 (EC 2.7.1.4)(ZmFRK1)
Function (paralog2):Fructokinase-1

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MAAGRELVVSFGEMLIDFVPTVAGVSLAEAPAFLKAPGGAPANVAIAVSRLGGGAAFVGK
LGDDEFGRMLAAILRDNGVDDGGVVFDSGARTALAFVTLRADGEREFMFYRNPSADMLLT
ADELNVELIKRAAVFHYGSISLIAEPCRTAHLRAMEIAKEAGALLSYDPNLREALWPSRE
EARTQILSIWDQADIVKVSEVELEFLTGIDSVEDDVVMKLWRPTMKLLLVTLGDQGCKYY
ARDFHGAVPSFKVQQVDTTGAGDAFVGALLQRIVKDPSSLQDEKKLVESIKFANACGAIT
TTKKGAIPSLPTEAEVLQLIEKA*

MAAGRELVVSFGEMLIDFVPTVAGVSLAEAPAFLKAAGGAPANVAIAVSRLGGGAAFVGK
LGDDEFGRMLAAILRDNGVDGGGVVFDAGARTALAFVTLRADGEREFMFYRNPSADMLLT
ADELNVGLIRRAAVFHYGSISLIAEPCRTAHLRAMEIAKEAGALLSYDPNLREALWPSRE
EARTQILSIWDQADIVKVSEVELEFLTGINSVEDDVVMKLWRPTMKLLLVTLGDQGCKYY
TRDFHGAVPSFKVQQVDTTGAGDAFVGALLRRIVKDPSSLQDEKKLVESIKFANACGAIT
ATKKGAIPSLPTETEVLQLIEKA*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):61GC content 2 (%):60GC content divergence:-0.008
Length 1 (bp):972Length 2 (bp):972Length divergence:0
MFE 1 (kcal):-431.1MFE 2 (kcal):-412.26MFE divergence-0.022