Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G086856-GRMZM2G056467
Species:maize
Duplication type:WGD
Function (paralog1):Putative uncharacterized protein
Function (paralog2):calmodulin binding protein

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MEVMVPVPVMAPSAPCSPRTATMAGGDHLPAYCYFFSSAPTSPSRASCNCNPASSPPGGD
EASTFDFTLGFSGQLQEATPTLAAADELFEGGRIRPLNAPHPSILRVANDASSGSADGTR
CSPRRAGGADRQAEAAPLERGRSGCRPSSAAAAAPSSSRSRSRRATRSLSPFRGGSGLDA
AAADDVDDESPPPSPRASSMIRGCGSGSGSRKWRLKDLFLFRSASEGRATGKDPLLKYTA
LSSASFWHPHGQPQRLSSASMSMRKGRGSAASAGDTPYATINRAAAAEDVRRRTTTATTT
PLPFHRNSLFGYLRSNPAIHSISRKLGGSGHSGSSSSSSRGGRQAAGRHDDPYARTARRT
APHQESRRR*

MEVVVPVMAPSAPCSPRTAAIAGDHLPAYCYFYSSAPTSPSRASCAGGAATATTTTPGSG
DEATFDFTLGFSGQLQEATPTLAAADELFEGGRIRPLNTPHPSIPLADDASSSSYSGGPR
WSPRRAGGADRRAEAPLERGRSGYRPAASTAAAAAAASSRSRRATRSLSPFRVRGGGGGG
GGVDDDEESPPSPRTSMMRGCGSGSKKWRLKDLFLFRSASEGRATTGGGSKDPLFKYTML
SSSSQQTLRTGGDGSASMRKGRGSAASASDMPMPYAVPRGAAAAEDARRRTTATTPLPFH
RNSLFGYLRSNPAIHSISRKLGGGGGGSSSSHPVPPAASNSSSRGRPT*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):71GC content 2 (%):73GC content divergence:0.014
Length 1 (bp):1110Length 2 (bp):1047Length divergence:-0.029
MFE 1 (kcal):-561.94MFE 2 (kcal):-583.9MFE divergence0.019