Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G086906-GRMZM2G073150
Species:maize
Duplication type:WGD
Function (paralog1):40S ribosomal protein S17-4
Function (paralog2):hypothetical protein LOC100194345

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MGRVRTKTVKKTSRQVIEKYYSRMTLDFHTNKKVLEEVSILPSKRLRNKVAGFSTHLMRR
IQRGPVRGISLKLQEEERERRMDFVPEKSALEVEEIRVDKETMEMLAALGMADLPGVERQ
AEVSNAPAYGRPQYGGPRRDRV*

MGRVRTKTVKKTSRQVIEKYYSRMTLDFHTNKKVLEEVSILPSKRLRNKVAGFTTHLMRR
IQRGPVRGISLKLQEEERERRMDFVPEKSALEVEEIRVDKETMEMLAALGMADLPGVERQ
AEVSSVPAYGRPQYGGPRRDRV*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):65GC content 2 (%):65GC content divergence:0
Length 1 (bp):429Length 2 (bp):429Length divergence:0
MFE 1 (kcal):-175.3MFE 2 (kcal):-178.7MFE divergence0.01