Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G086920-GRMZM2G143402
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100384736
Function (paralog2):hypothetical protein LOC100383759

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.46601892295872
Log2 mRNA fold difference:0.44191003116513
Log2 TE fold difference:0.020214883127584
Sequences
Protein sequence

MDLLERNIKTETEETRKEQERKEEEAEAEAEAGERKTQEPPQQGQGLSLSLANGSGRSGM
LPMSNVSANPSQLTIFYGGSVCVYDSVPPEKAQAIMLIAAAAAAAAATKSSAAPTVKPPM
VPAATVAPAAVVSPVLTRSPSLQSTSVATGQPQVVAEPSSICKLQADLPIARRHSLQRFL
EKRRDRVVSKAPYSTAKSSDGMESPRIEVTAEGKAQ*

MDRLEERNIKKGEREMEEARKEEERKEEAGDRNTQEPQQGQGLSLSLANGSDSGRSGMLP
MSNPSANPTQLTIFYGGSVCVYDSVPPEKAQAIMLIAAAAAAAAATKGSAATAFNPPMVH
TDTVAPAAVFSPVLTRSPSLQSTSVAAGQAQVVADPSSISKLQADLPIARRHSLQRFLEK
RRDRVVSKAPYSPAKSFDGMESAGMEMTADGKQGARPSILKGWGAAKSEV*

Other information
Ka divergence:0.191828KaKs divergence:0.138057
GC content 1 (%):57GC content 2 (%):56GC content divergence:-0.009
Length 1 (bp):651Length 2 (bp):693Length divergence:0.031
MFE 1 (kcal):-253.92MFE 2 (kcal):-259.52MFE divergence0.011