Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G086992-GRMZM2G078924
Species:maize
Duplication type:WGD
Function (paralog1):Ubiquitin-fusion protein
Function (paralog2):Ubiquitin-fusion protein

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MSGVQEQFEIKFRLPDGTDIGPRRFPPASTVATLKETIIAQWPKDKEKGPRTVNDLKLIN
AGKILENNKTLSECKSPICDFSAMTTMHVVIRAPTSSKQSDKRAEKKAKNFRCGCAIM*

MSGVQEQFEIKFRLPDGIDIGPRRFPPASTVATLKETIIAQWPKDKEKGPRTVNDLKLIN
AGKILENNKTLSECKSPICDFSGMTTMHVVVRAPTSSKQSGKRAATKAKGFRCGCAIM*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):51GC content 2 (%):54GC content divergence:0.029
Length 1 (bp):357Length 2 (bp):357Length divergence:0
MFE 1 (kcal):-114.51MFE 2 (kcal):-115.52MFE divergence0.004