Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G087032-GRMZM2G107491
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100194377
Function (paralog2):zinc finger CCCH type domain-containing protein ZFN-like 2

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.93674379783144
Log2 mRNA fold difference:-1.1242840253148
Log2 TE fold difference:0.22261163325944
Sequences
Protein sequence

MDDAGRPPPHAPVAVTASASASATAAPAPPQPSATAAVDRSSPDPDALYEEGMWQQMAMD
SGATMQPGSYPERPGEPDCTYYLRTGLCRFGMSCRFNHPPDRNLAIASARMKGEYPERAG
QPECQYYLKTGTCKFGPTCKFHHPREKAGIAGRVQLNTSGYPLRPNEKECAYYLKTGHCK
YANTCKFHHPELFNVVPSSRGSPIYTSVHSSASAGPQSYTGTMPSWAFPRASFIPSPRWQ
SPSNYAPMIVPQGLVQMQSWNSYTGQLQSPGAQQTYGSSQQGEASTGNQGMLSPYRPSSF
PVPQYALQRENVFPERPDEPECQYYMKTGDCKFGAVCKFHHPRVRSLPPPDCVLSPMGLP
LRPGEELCKFYSRYGICKFGANCKFDHPTVVAPMVYAYGFSASASPASASTNVPMARRLL
GSPPGSGYTS*

MDDAGRAPPPAPAAVTVSATAAPAPTPPSATAAADKSSLDPDALYEEGMWQQMAMNSGAT
MQPGSYPERPGEPDCTYYLRTGLCRFGMSCRFNHPPDRNLAIASARMKGEYPERVGQPEC
QYYLKTGTCKFGPTCKFHHPREKAGIAGRVQLNTLGYPLLPNEKECAYYLKTGQCKYANT
CKFHHPELFNVVPSSRGSPIYTSVHSSASAGPQSYTGTMSSWTFPRASFIPSPRWQSPSN
YAPMVVPHGLVQVPSWNSYPGQLQSPGAQQTYGSSQQGEASAGNQGMLSPYRSSSFPVPQ
YALQRDNVFPERPDEPECQYYMKTGDCKFGAVCKFHHPRVRSQPPPDCVLSPMGLPIRPG
EELCKFYSRYGICKFGANCKFDHPTMAAPMGVYAYGFSGSASVAPASTNAPMTRHLLGSP
SGSGYMS*

Other information
Ka divergence:-0.0996525KaKs divergence:-0.177797
GC content 1 (%):51GC content 2 (%):49GC content divergence:-0.02
Length 1 (bp):1293Length 2 (bp):1284Length divergence:-0.003
MFE 1 (kcal):-420.93MFE 2 (kcal):-403.24MFE divergence-0.021