Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G087069-GRMZM2G385428
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100274853
Function (paralog2):hypothetical protein LOC100277421

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.66517440482098
Log2 mRNA fold difference:-0.25919909442829
Log2 TE fold difference:0.91161571806711
Sequences
Protein sequence

MRRAGGLSRAGHGAAPAAGVMRAAASAFFAGYHCFTSVAALLALPFSAAVLVAEAAAAAP
APAPVALRALAARLRAVFAAAGFPPSPFFALLEAKLSQTVFTFAAALPFALTFLLLAKAC
VAAMLRDDAASPRRHRRRRWPGVAALPACGAVARAYPAVLATHVLGAFLMLSANAAAFSL
LLLAFGAADLLGLTSRAWTLALSAAGAVAYSLAVGVAAVVCNLAVVVAATEPGCAGHAAV
LRACVAIRGRVSTALALALPTNLGMAAAEALFGLRVVAQRRRDGRLAPAVAAEAFSIAYI
HAVCVVLEIIVACVFYRSCKRSEADELRELEPEEKGDLQA*

MGRAAGLARDGVTTAGRATTTRVMRAAVSAFFAGYHRFTSVAALLALPFSAAVLASEAMA
PSSWALRAVAARLRSVFAAAGFPPSPFFALLEAKLSQTVFTFAATLPFALTFLLLAKACV
AAMLRLRDDDASESPPPRRRRVAVAALPPCAAVARAYPAVVATHLLNAFLMLSANAAVFS
LLLLAFGAADLLGLTSHVWTLALSAAGAIVYSLVVGVATVVCNLAIVVAATEPGCAGHAA
VLRACVAIRGRVSTALALALPTNLGMAAAEALFGLRVVAQRRRDGRLAPGVAGEAFSIAY
IHAICVVLEIIVTCMFYRSCKRSEADELRELEPEEKGDLQA*

Other information
Ka divergence:-0.313912KaKs divergence:-0.313564
GC content 1 (%):76GC content 2 (%):73GC content divergence:-0.02
Length 1 (bp):1023Length 2 (bp):1026Length divergence:0.001
MFE 1 (kcal):-598.11MFE 2 (kcal):-565.3MFE divergence-0.028