Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G087150-GRMZM2G104226
Species:maize
Duplication type:TD
Function (paralog1):LOC100282715
Function (paralog2):

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-3.2077905293857
Log2 mRNA fold difference:-2.4233950544699
Log2 TE fold difference:-0.75557927345903
Sequences
Protein sequence

MHSSASARGGRGLLLPAAAAAVVVLLLGAVAPAAGCYPRVFNFGDSLADTGNYPFVYGND
SAKLRPPYGETFFHRATGRASNGRLVVDFIADTLGLPFVRPYLSGRSAEDFAGGANFAVG
GATALSPDFFRARGFHNMGNRVDLDMEMKWFRGLLDLLCPGNLAGCSDMMNQSLFLVGEI
GGNDYNGPLLSGVPFEEIRAITPSVVAKISSTISELIQLGAKTLVVPGNLPIGCVPKYLM
IFKSNKKEDYDPQTGCLRWMNEFSQYHNKLLVEQLKKLRRLHPGVTIIYADYYGAAMEIF
LSPERYGIEYPLVACCGAEGPYGVSPTTSCGLGEYKLCDNPERYGSWDGLHPTESAYKVI
AMGLLLGSYTRPPIASTTTSCPQLMELGSSAEYKRLYDL*

MASSAPGRGGRQLILLPAAAAAVAVMVLIGAEPALACYPRVFSFGDSLADTGNFRFYYGN
SSGEPALRQPYGETFFRRATGRFSNGRLILDFIADTMGLPFVRPYLSGRRAEDFASGANF
AVGGATALGPDFFRSRGFDIGDGRVHLGMEMKWFHDLLELLCRSGRSGCSDIMSQSLFIV
GEIGGNDYNLPMLSRVPIEKIRSFTPNVIAKISSTITELIGLGAKTLVVPGNLPIGCVPK
YLLIFKSDDKEDYEPETGCLRWMNEFSEYHNKLLLEELEKLRKTNPTVTIIYADYYGAAM
EIFRSPERFGIEEPLVACCGGEGPYGVSLSTACGYGDYKVCDNPDKYGSWDGFHPSEAAY
KAIAMGLLRGTYTQPSIASTTSSCPQLTELGSSVEYKSCGTVLHFSAVAQAIGWVLFYLL
FFSHSARIRN*

Other information
Ka divergence:-0.205431KaKs divergence:-0.302895
GC content 1 (%):55GC content 2 (%):54GC content divergence:-0.009
Length 1 (bp):1200Length 2 (bp):1293Length divergence:0.037
MFE 1 (kcal):-471.92MFE 2 (kcal):-489MFE divergence0.018