Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G087275-GRMZM2G144985
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):serine palmitoyltransferase 1

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0.17365333008754
Log2 mRNA fold difference:0.75351390474994
Log2 TE fold difference:-0.59352157997799
Sequences
Protein sequence

MDMALPVVNATAAVLARVSAAFNAPLARAVVFGVHIDGHLVVEGLLIAVIVFQLSRKSYK
PPKKPLTEKEIDELCDEWEPEPLCPPVKEGARIDTPMLESAAGPHTIVDGKEVVNFASAN
YLGLIGNEKIIDSCIGSLEKYGVGSCGPRGFYGTIDVHLDCESKIAKFLGTPDSILYSYG
ISTIFSVIPAFCKKGDIIVADEGVHWAVQNGLHLSRSTVVYFKHNDMVSLASTLEKLTHG
NKRAEKIRRYIVVESIYQNSGQIAPLDEIVRLKEKYRFRVILEESHSFGVLGKSGRGLAE
HYGVPIEKIDIITAGMGNALATDGGFCTGSVRVVDHQRLSSSGYVFSASLPPYLATAAVS
AVNYLEQNPAVLANLRSNIALLHKELSDTPGLEIFSHVLSPIVFLKLKKSTGSPTTDLDL
LETIAGRVLKEDSVLIVTSKKSNLDRCKLPVGIRLFVSAGHTESDISRLSSSLKRVSAAV
LSDCF*

MDMALPVVNATAAVLARVSAAFNGPLARAVVFGVHIDGHLVVEGLLIAVIVFQLSRKSYK
PPKKPLTEKEIDELCDEWEPEPLCPPIKEGAKIDAPTLESAAGPHTIVDGKEVVNFASAN
YLGLIGNEKIIDSCISSLEKYGVGSCGPRGFYGTIDVHLDCESKIAKFLGTPDSILYSYG
ISTIFSVIPAFCKKGDIIVADEGVHWAVQNGLHLSRSTVVYFKHNDMASLASTLEKLTRG
NKRAEKIRRYIVVESIYQNSGQIAPLDEIVRLKEKYRFRVILEESHSFGVLGKSGRGLAE
HYGVPIEKIDIITAGMGNALATDGGFCTGSVRVVDHQRLSSSGYVFSASLPPYLASAAVS
AVNYLEENPSVLANLRSNIALLHKELSDTPGLEISSHVLSPIVFLKLKKSTGSPTTDLDL
LETIADKALKEDSVFVVTSKKSNLDRCKLPIGIRLFVSAGHTELDISRLSSSLKRVSASV
LSDYF*

Other information
Ka divergence:-0.114396KaKs divergence:-0.233405
GC content 1 (%):45GC content 2 (%):44GC content divergence:-0.011
Length 1 (bp):1458Length 2 (bp):1458Length divergence:0
MFE 1 (kcal):-454.31MFE 2 (kcal):-460.1MFE divergence0.006