Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G087625-GRMZM2G140231
Species:maize
Duplication type:TD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.90643643892915
Log2 mRNA fold difference:-0.3511967476783
Log2 TE fold difference:1.2028041930618
Sequences
Protein sequence

MAHNLLPVAVVLAVALLMAPAAGYPWLSCGTSSSFAANGTYQDHFNFAAATLPKNASTSP
DLFASIVVGTVPEQLSAMALCRGDVNSTTCFSCLTEAFGDLPSACSDDKAATIYYDPCMV
HYSDVHTLPGDDDTGPSIDTYPIGDNQYVTADPGQFIRLLAALVNATADYAAYNSTRRFA
TGQADTGFDPEFPELYALAQCTPDQTPAQCHKCLAGLISQSLGGFQNRDGARMLAVSCTY
RYETKPFYNGPAMVRLASPSSGAPAPAPAVNSRVRAADGGRRKYHVPWVAIAVVLPALAA
MNLVACLCFRRRRRRLLIAQAKHQNPMYSTEAEDTEMVDSMMMDVSALRAATGDFDESNK
LGEGGFGAVYKGVLPDGEEIAVKRLSSSSSQGVQELKNELALVAKLKHRNLVRLIGVCLG
QQERLLVYEFLPNRSLDLILFDTENEERGRRRLDWAQRYKIINGVARGLQYLHEDSQLKV
VHRDLKASNVLLDENMNPKISDFGLARIFGRGQTQAVTRRVVGTYGYMAPEYMMRGNYSV
RSDAFSFGVMVLEVVTGRKNSDDGCNLLATVWTHWEAGTVAQLVEPSTMGGSFPEGDVLR
CVHIGLLCVQADPAARPVMSSVVMMLGSDTVTLQAPSKPGFFVRNNSANAAASTVSLDG*

MANHLVPCAAIVAAVVLLMPCATGYPWPFCHDSDNFKANSSYQAHLDFVAATLPMNASAS
PDLFATAVVGTVPEQLWAVGLCRGDVNATACFNCLTQAFRDLQNDCSYDKGATIYYDPCM
LHYSDNQQLLADDESDLPYFISYNGNVTSDQARFNGLVAELVNATAEHAAYNSTRRFATG
ESRAGFEPKVYSLAQCTPDLTAARCRTCLEAIISQSLDGFQNLVGGRALWINCTYRYETA
PFFDGPAMVQIAPPPSSGAPAPAPTVAPSMQPTSGTPAAVAGGGEFLSVRQTVSTETYVC
RTHLIACIRQSTGGRKYSRLPSVVVAAVLAAVTALNLAACLCFWRRRRRTAEEKQTYPMY
STVAEDTDMVDSMMMDASILRAATGDFDESNKLGEGGFGAVYKGVLPDGGEVAVKRLSQG
SSRGVEELKNELALVAKLRHKNVVTLVGICLEQQERLLVYEFVANRSLNLIIFDAEKRER
LDWRHRHQIINGIARGLQYLHEDSQLKVVHRDLNPSNILLDANMDPKISGFGLARIVGRD
QQTQAVVSQGVVGTYGYMAPEYALRGNYSVKSDAFSFGVTVLEIISGRKNSAIYNGGKPD
DLLDTVWQHWEAGTVVETVDPCMDGGFPEGDVLRCIHVALLCVQGDPAARPAMSSVVMML
GGDTITLQAPSKPMIFEYYQESPENE*

Other information
Ka divergence:0.185349KaKs divergence:0.327166
GC content 1 (%):65GC content 2 (%):62GC content divergence:-0.024
Length 1 (bp):1980Length 2 (bp):2061Length divergence:0.02
MFE 1 (kcal):-890.52MFE 2 (kcal):-908.23MFE divergence0.01