Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G088053-GRMZM2G108537
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100273211
Function (paralog2):nodulin protein (LOC100282610), mRNA

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.86202517340587
Log2 mRNA fold difference:0.24225017744712
Log2 TE fold difference:-1.1143354259848
Sequences
Protein sequence

MGVGKLMNDVKPYLAMVLLQVGFSGMYIVSVASLKRGMNHFVLVVYRNLVATVVLAPFAL
LFERRVRPKMTPLIFLKIMGLAVLEPVLDQNMYYLGAKLTSATFASALVNILPAITFLMA
LVLRMERLRLRSLRSQAKVAGTVCTVVGAVLMILYHGPVVPFPWSAGHHQASAAAAAAAA
ESQSSASWLNGIVMIIGSCLCWSGFFVLQSNTLQSYPAELTLATLICFLGSVLTGGVALV
AERHDMSAWVIGFDTRLFTAVYSGIVCSGVAFYVQGIVTQARGPVFVTAFQPLCMIITTV
LGSTILKEETTLGSVIGAAIIVVGLYCLIWGKSKDHLGNGGKPAVAELPLTSAPNGGTNG
YGKHALGGGGGGHHVAAGVEAPPPSSKCVH*

MGVGKLMNDVKPYLAMVLLQVGFSGMYIVSVASLKRGMNHFVLVVYRNLVATVVMAPFAL
LFERRVRPKMTPLIFLKIMGLAVLEPVLDQNMYYLGAKLTSATFASALVNILPAITFLLA
LALRMERLRLRSLRSQAKVVGTVCTVAGAVLMILYHGPVVPFPWSAGRLHHHVPAAAVES
QSSASWLNGICMIIGSCLCWSGFFILQSNTLQSYPAELTLTTLICFLGSVLTGGVALVAE
RRDMSAWVIGFDTRLFTAVYSGIVCSGVAFYVQGIVTQARGPVFVTAFQPLCMIITTVLG
STILKEETTLGSVIGAAIIVVGLYCLIWGKSKDHLGSNGGKPGAAAVAELPLTSSAPAWS
NGKQALAVVETTPPSSLPNKCVH*

Other information
Ka divergence:0.127162KaKs divergence:-0.0163934
GC content 1 (%):67GC content 2 (%):65GC content divergence:-0.015
Length 1 (bp):1173Length 2 (bp):1152Length divergence:-0.009
MFE 1 (kcal):-601.1MFE 2 (kcal):-539.76MFE divergence-0.054