Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G088590-GRMZM2G171847
Species:maize
Duplication type:WGD
Function (paralog1):Zn-finger, RanBP-type, containing protein
Function (paralog2):hypothetical protein LOC100192683

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-1.4291818017991
Log2 mRNA fold difference:-1.1950841684875
Log2 TE fold difference:-0.3004694868427
Sequences
Protein sequence

MASAKFGAAQQVENRGALSKRSRNDVSVREGDWNCPQCGNVNFSFRNVCNRGACGAPRPS
PSPSPRMMSGPPASGYDRSPLFYGGGGGAPPPIPLGTGSYGAPYPHLGMRYGYGPPVGPP
GSYGLFSSYGPPGPMSGMGYGPGPELGRYSYGFRGSPMPVSSPWSGGALAENNDNIASRK
RRGGPDGLSEGDWTCPKCDNINFSFRSTCNMKKCGAPRPTPGGNTSSSRKDNSNKEAPEG
SWTCPECNNLNYPFRTVCNRKGCSYSKPAPANN*

MAFAKVGAATQLENRGALSKRLRNDVSVREGDWNCPQCGNVNFSFRNVCNRGACGAPRPS
PSPSPRMMPAPPAPGYDRLPLFYGGGGGAPSPISLGSGSYGGPYPHLGMRYGYGPPVGAP
GSYGLFSSYGQPGPMSGMGYGPGPELGRYSYGFRGSPMPVSSPWSGGAIAENNDNIASRK
RRGGPDGLSEGDWTCPKCDNINFSFRNTCNMKKCGAPRPTPGANTSSSRKDNKEAPEGSW
TCPECNNLNYPFRSVCNRKGCSYNKSAPTNN*

Other information
Ka divergence:0.0881091KaKs divergence:-0.271872
GC content 1 (%):53GC content 2 (%):51GC content divergence:-0.019
Length 1 (bp):822Length 2 (bp):816Length divergence:-0.004
MFE 1 (kcal):-300.1MFE 2 (kcal):-286MFE divergence-0.024