Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G088834-GRMZM2G126860
Species:maize
Duplication type:WGD
Function (paralog1):vacuolar sorting protein 4b
Function (paralog2):Putative uncharacterized protein

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.56208954620331
Log2 mRNA fold difference:0.63169243741438
Log2 TE fold difference:-0.076934936102033
Sequences
Protein sequence

MYSNFKEQAIEYVKQAVQEDNAGNYVKAFPLYMNALEYFKTHLKYEKNPKIKEAITAKFT
EYLRRAEEIRAVLDEGGAGPGANGGDAAVATRPKTKGKDGDGGNGGDDSEQSKLRAGLNS
AIITEKPNIKWNDVAGLESAKQALQEAVILPVKFPQFFTGKRRPWRAFLLYGPPGTGKSY
LAKAVATEADSTFFSISSSDLVSKWMGESEKLVANLFQMARENAPSIIFIDEIDSLCGQR
GEGNESEASRRIKTELLVQMQGVGHNDDKVLVLAATNTPYALDQAVRRRFDKRIYIPLPD
LKARQHMFKVHLGDTPHSLTESDFESLARRTDGFSGSDVAVCVKDVLFEPVRKTQDAMFF
FKADGDMWMPCGPKQPGAVQTTMQELASKGLAAKILPPPISRADFEKVLSRQRPTVSKKD
LEVHERFTKEFGEEG*

MPPILFSPQPKHASPFPSFPFLSLVSSRLRSPFLLRTPSSPHRVKPQHKSTARRLRSPPV
PNQPLRCPIRPIPPPIRRRGGASGPTPMYSNFKEQAIEYVKQAVQEDNAGNYVKAFPLYM
NALEYFKTHLKYEKNPKIKEAITAKFTEYLRRAEEIRAVLDEGGAGPGANGGDAAVATRP
KTKGKDGDGGNGGDDSEQSKLRAGLNSAIITEKPNVKWNDVAGLESAKQALQEAVILPVK
FPQFFTGKRRPWRAFLLYGPPGTGKSYLAKAVATEADSTFFSISSSDLVSKWMGESEKLV
ANLFQMARENAPSIIFIDEIDSLCGQRGEGNESEASRRIKTELLVQMQGVGHNDDKVLVL
AATNTPYALDQAVRRRFDKRIYIPLPDTKARQHMFKVHLGDTPHSLTESDFESLARRTDG
FSGSDVAVCVKDVLFEPVRKTQDAMFFFKADGDMWMPCGPKQPGSVQTTMQELASKGLAA
KILPPPISRTDFEKVLSRQRPTVSKKDLEVHERFTKEFGEEG*

Other information
Ka divergence:-0.206897KaKs divergence:-0.304762
GC content 1 (%):54GC content 2 (%):54GC content divergence:0
Length 1 (bp):1308Length 2 (bp):1569Length divergence:0.091
MFE 1 (kcal):-484.92MFE 2 (kcal):-554.41MFE divergence0.067