Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G089351-GRMZM2G132686
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100272566
Function (paralog2):hypothetical protein LOC100280257

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-1.0419649229531
Log2 mRNA fold difference:-1.029248058801
Log2 TE fold difference:0.040733737824829
Sequences
Protein sequence

MNGGGGRRRYSSEQLLFDVPSNAGAGRWAQQSGGVRRGDGEIFVSVEPATPARLRGGDAA
AGDSPGQRQQLSPGLLDLHAFDTELIPDFQVPGMYDGAQKFGYGGGLDESDMRFTANKLM
SKSAVFPDGNYLKAFTEKEKAAPVAKIKVVVRKRPLNKKEVSKKEEDIIDIEQRSNSLTV
HETKLKVDLTEYVEKHEFVFDAVLDEDVSNDEVYRETVEPVVPSIFNRTKATCFAYGQTG
SGKTYTMRPLPLKASQDILRLMHHAYRNQGFQLHVSFFEIYGGKLFDLLNDRSKLCMRED
AKQKVCIVGLQEYRVSDVETIKELIEKGSATRSTGTTGANEESSRSHAILQLAIKRRVDG
NDSKPPRPVGKLSFIDLAGSERGADTSDNDKQTRIEGAEINKSLLALKECIRALDNDQTH
IPFRGSKLTEVLRDSFIGDSRTVMISCISPSSGSCEHTLNTLRYADRVKSLSKGSNAKKD
VSLAVPLRESSPSPLPSVVPSFSASEVMNDITERNNFGWPKQQYVKERPAPTFVERMPKV
KDAVEFATSDGAYLKGQRSQGCMAPNIAEIPDTMYQQRRQPARKAKDTALRNNMRNSVAY
PTRSVEPDEDDHLNNLLQEEEGLVSAHREQVEATLDILKEEMNILGEADQPGFQLDDYNI
TRLSSILSQKAAGIVDLQARLEQFQRLLDENNVLLYAQSPRL*

MNGGSRRQRYSSEQLLFDVPANAGAGRWAQQRGGVRRGDGEIFVSVEPATPARLCGGDAA
AGDSPGQRQQLSPGLLDLHAFDTELIPDFQVPGIYDGAQKFGYGGGLDESDMRFTSNKMM
SKSTIFPDGNYLKAFTEKEKAAPVAKIKVVVRKRPLNKKEVSKKEEDIVDIEQRSNSLTV
HETKLKVDLTEYVEKHEFVFDAVLDEDVSNDEVYRETVEPVVPAIFNRTKATCFAYGQTG
SGKTYTMRPLPLKASQDVLRLMHHTYRNQGFQLYVSFFEIYGGKLFDLLNDRSKLCMRED
GKQKVCIVGLQEYRVSDIETIKELIEKGSATRSTGTTGANEESSRSHAILQLAIKRRVDG
NDSKPPRPVGKLSFIDLAGSERGADTTDNDKQTRIEGAEINKSLLALKECIRALDNDQTH
IPFRGSKLTEVLRDSFIGDSRTVMISCISPSSGSCEHTLNTLRYADRVKSLSKGSNAKKD
VSLAVPLRESNSSPLPSVVPSFSASEVMNDITGRSNFGWPKQQYVKEQPAPTFVERMPKA
KDAVEFTSSNIAEVPDIMYQLGRQPSRKDVTLANNMRNSVAYPTRRVEPDDDDEHLNNLL
QEEEELVSAHRKQVEETLDILKEEMNILGDADQPGFQLDDYITRLSSMLSQKAAVIVDLQ
ARLEQFQRLLNENNVLLYAQSP*

Other information
Ka divergence:0.0456929KaKs divergence:-0.0062179
GC content 1 (%):47GC content 2 (%):47GC content divergence:0
Length 1 (bp):2109Length 2 (bp):2049Length divergence:-0.014
MFE 1 (kcal):-725.11MFE 2 (kcal):-688.8MFE divergence-0.026