Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G089454-GRMZM2G171060
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100193835
Function (paralog2):ADP-ribosylation factor-like protein 8A

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.25726315514061
Log2 mRNA fold difference:0.1681859952034
Log2 TE fold difference:0.11208941144415
Sequences
Protein sequence

MGLWDSLLNWLRRMLGRHRWSMLLLYASTQSRYITMLSGVLILIHGFCALQTGGYSEDMI
PTVGFNMRKITKGNVTIKLWDLGGQRRFRTMWERYCRGVSAILYVVDAADRDSIPIAKSE
LLDLLTKQSLAGIPLLVLGNKIDKSEVLSKQALVDQLGLESIKDREVCCYMISCKDSVNI
DIVIDWLIKHSRTAK*

MGLWDSLLNWLRSLFFKQEMELSLVGLQNAGKTSLVNAVATGGYSEDMIPTVGFNMRKVT
KGNVTIKLWDLGGQRRFRTMWERYCRGVSAILYVVDAADRDSVPIAKSELHDLLTKQSLA
GIPLLVLGNKIDKSEALSKQALVDQLGLELIKDREVCCYMISCKDSVNIDVVIDWLIKHS
RTAK*

Other information
Ka divergence:-0.9416KaKs divergence:-0.968691
GC content 1 (%):45GC content 2 (%):50GC content divergence:0.053
Length 1 (bp):588Length 2 (bp):555Length divergence:-0.029
MFE 1 (kcal):-175.49MFE 2 (kcal):-190.2MFE divergence0.04