Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G089493-GRMZM2G418343
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100191708
Function (paralog2):Putative uncharacterized protein

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-0.81994098301305
Log2 mRNA fold difference:-0.76675593506865
Log2 TE fold difference:0.20893396361865
Sequences
Protein sequence

MARWSSSALVAVLVVLAAAVACSAARPVPAQQQQQAGEDVKRPDTLHEGTVLIPGMGRYE
IGSHYIPDIGGLDHSIPAATHGQFLPGADDTWVPNPGFEVPNPFMPGAATP*

MASSSSSSSALVVLVVVLAAAVACSATRPVPARQRAAAAEEEDVRRPDTLHEGTVLIPGM
GRYEIGSHYIPDIGGLDHSVPAATHGQFIPGADDTWVPNPGFEVPNPFRPGAATP*

Other information
Ka divergence:0.288389KaKs divergence:0.0971928
GC content 1 (%):72GC content 2 (%):73GC content divergence:0.007
Length 1 (bp):336Length 2 (bp):348Length divergence:0.018
MFE 1 (kcal):-164.9MFE 2 (kcal):-173.2MFE divergence0.025