Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G089630-GRMZM5G823629
Species:maize
Duplication type:WGD
Function (paralog1):integral membrane protein like
Function (paralog2):hypothetical protein LOC100193090

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:1.1397537371176
Log2 mRNA fold difference:0.95557815085747
Log2 TE fold difference:0
Sequences
Protein sequence

MPTNLDFFWGKIFLGHPCPLLGSPLQKTGVDSTCQDSMAPGSKAERKAALDAGAWMFNVV
TSVGIIMVNKALMATHGFSFATTLTGLHFAMTTLMTLVMKWLGYIQPSYLPLPELVKFAF
FANLSIVGMNVSLMWNSVGFYQIAKLCIIPVLCILEIMFDKVRYSRDTKLSIVLVLVGVA
VCTVTDVSVNSQGLLAAVIAVWSTALQQHYVHHLQWKYSLGSFNLLGHTAPAQAASLLVL
GPFVDFWLTNKRVDAFNYTSIVTFFIVLSCIIAVGTNLSQFICIGRFTAVSFQVLGHMKT
VLVLTLGFFFFGKEGLNFHVALGMFLAVIGMIWYGNASSKPGGKERQVYSTPSEKTQKHG
VLSSQSELDQKV*

MAPGSKAERKAALDAGAWMFNVVTSVGIIMVNKGLMATHGFSFATTLTGLHFAMTTLMTL
VMKWLGYIQPSYLPLPELVKFAFFANLSIVGMNVSLMWNSVGFYQIAKLCIIPVLCILEI
IFDKVRYSRDTKLSIVLVLIGVAVCTVTDVSVNSQGLLAAVIAVWSTALQQHYVHHLQWK
YSLGSFNLLGHTAPAQAASLLIVGPFVDFWLTNKRVDAFNYTSIVTFFIVLSCIIAVGTN
LSQFICIGRFTAVSFQVLGHMKTVLVLTLGFLFFGKEGLNFHVALGMLLAVIGMIWYGNA
SSKSGGKERQVYPTPSEKSQKHGALSSQSELDQKV*

Other information
Ka divergence:0.607572KaKs divergence:0.54717
GC content 1 (%):46GC content 2 (%):46GC content divergence:0
Length 1 (bp):1119Length 2 (bp):1008Length divergence:-0.052
MFE 1 (kcal):-367.81MFE 2 (kcal):-310.2MFE divergence-0.085