Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G089736-GRMZM2G101769
Species:maize
Duplication type:WGD
Function (paralog1):pnFL-2
Function (paralog2):pnFL-2

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0.35338442469374
Log2 mRNA fold difference:-0.19712231107889
Log2 TE fold difference:0.45476698225494
Sequences
Protein sequence

MAASARPGERATSFAVACSLLSRFVRQNGVAAADLGLRIKGEVEQQRTPATTNSLPGAEG
EEVERRKETMELFPQSVGFSIKDAAAPREEQGDKEKPKQLTIFYGGKVLVFDDFPADKAK
DLMQLASKGSPVVQNVALPQPSAAAAVTTDKAVLDPVISLAAAKKPARTNASDMPIMRKA
SLHRFLEKRKDRLNAKTPYQTAPSDAAPVKKEPESQPWLGLGPNAVDSSLNLS*

MAASARPGERATSFAVACSLLSRFVRQNGAAPAQLGLGIKGEVEQQRTPATINLLPGADG
EETERRKETMELFPQSAGFGVKDAAAAPREQENKEKPKQLTIFYGGKVLVFDDFPADKAK
DLMQLASKGGPVVQNVVLPQPSAPAAAVTDKAVPVPVISLPAAQADAKKPTRTNASDMPI
MRKASLHRFLEKRKDRLNANAPYQTSPSDAAPVKKEPESQAWLGLGPNAVKSNLNLS*

Other information
Ka divergence:-0.23356KaKs divergence:-0.608563
GC content 1 (%):59GC content 2 (%):59GC content divergence:0
Length 1 (bp):702Length 2 (bp):714Length divergence:0.008
MFE 1 (kcal):-287.3MFE 2 (kcal):-274.64MFE divergence-0.023