Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G089850-GRMZM2G009406
Species:maize
Duplication type:WGD
Function (paralog1):Putative uncharacterized protein
Function (paralog2):hypothetical protein LOC100194004

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MQLSHTAPRMQEPGRRPVPPFAGVDLRRPRGYPAPAAKEAEEEPAPAPAPGGDPCPRCGS
RDTKFCYYNNYNTSQPRHFCKSCRRYWTKGGSLRNVPVGGGTRKSGSSSSASASATPTST
GAAPKSPRSSKNSKRRRVGPAPAPDPAPATATATADVANTAPSTEAAAATRAASEKPAAT
EPAAATGAASEKPAATELAAAVVSTEKPPAAVGGFTDTSTTVPEIGLADVCSGGVKELVP
DPGHFEWPSGCDLGSYWGTSVFADTDPALFLNLP*

MQEEPGRRPVPPFAGVDLRRPKGYPVAVAKEEERPAPGGDPCPRCGSRDTKFCYYNNYNT
SQPRHLCKSCRRYWTKGGSLRNVPVGGGTRKSSSSSSSSSSSATTTSTSPGAAPKATKRS
KNSKRRRVAPAPDPAAPGTDASTADVASTAPSAATVTASEKPSATEHAAAAVATEKPPAA
LPVSVGAFADTSPAPDAGSGGVRELLPHPSRFEWPSGCDLGPPYWGWGTSVFADTDPALF
LNLP*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):72GC content 2 (%):73GC content divergence:0.007
Length 1 (bp):825Length 2 (bp):735Length divergence:-0.058
MFE 1 (kcal):-421.9MFE 2 (kcal):-388MFE divergence-0.042