Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G089952-GRMZM2G142315
Species:maize
Duplication type:TD
Function (paralog1):LOC100283884
Function (paralog2):phosphatidylinositol transfer protein CSR1

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:1.4078068570459
Log2 mRNA fold difference:2.5935597706216
Log2 TE fold difference:-1.1795804019288
Sequences
Protein sequence

MASAAGGGAAGEGEWLKVSQLRPMVEAQDPNAKAVDNLTLRRFLRARDHDVDKASAMFLK
FLKWRREAAPGGSVPEEQVRRELSQDKLCMGGVDRAGRPILVAFAARHFSAGRDMAEFKS
FVVYFFDKICARIPRGQEKFLCIVDLKGWGYSNCDVRAYIAAIEILQNYYPERLGKALMI
HVPYIFMKAWKMIYPFIDTNTRDKFVFVEDKSLQETLRREIDEGQLPEFLGGKMDVIPLK
DYGVQQQPQAV*

MANAGGGAAEEGEWLKVAQLRALVQEDHRAKEVDNLTLRRFLRARGHNVDKAAAMLLKFL
RWRAEAAPGGGTVREEQVRGELEQDKIYMGGVDRTGRPIIVGLLAKHYSANRDMAEFKSF
VVYFFDKICARIPRGQEKFLAIMDLKGWGYANCDVRAYIAAIEIMQNYYPERLGKALMIN
VPYIFLKVWKTMIYPFIDANTRDKFVFVDDKSLRETLRREIDESQLPEFLGGKMPLVSLK
DYAQQPQPVCE*

Other information
Ka divergence:0.0533618KaKs divergence:0.180809
GC content 1 (%):62GC content 2 (%):64GC content divergence:0.016
Length 1 (bp):756Length 2 (bp):756Length divergence:0
MFE 1 (kcal):-332.8MFE 2 (kcal):-347.4MFE divergence0.021