Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G090432-GRMZM2G312069
Species:maize
Duplication type:TD
Function (paralog1):Cytochrome P450 CYP81A9
Function (paralog2):hypothetical protein LOC100274473

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-3.9981646599603
Log2 mRNA fold difference:-3.977138390925
Log2 TE fold difference:0.48276904827866
Sequences
Protein sequence

MDKAYIAALSAAALFLLHYLLGRRAGGEGKAKAKGSRRRLPPSPPAIPFLGHLHLVKAPF
HGALARLAARHGPVFSMRLGTRRAVVVSSPDCARECFTEHDVNFANRPLFPSMRLASFDG
AMLSVSSYGPYWRNLRRVAAVQLLSAHRVGCMAPAIEAQVRAMVRRMDRAAAAGGGGVAR
VQLKRRLFELSLSVLMETIAHTKTSRAEADADSDMSTEAHEFKQIVDELVPYIGTANRWD
YLPVLRWFDVFGVRNKILDAVGRRDAFLGRLIDGERRRLDAGDESESKSMIAVLLTLQKS
EPEVYTDTVITALCANLFGAGTETTSTTTEWAMSLLLNHREALKKAQAEIDAAVGTSRLV
TADDVPHLTYLQCIVDETLRLHPAAPLLLPHESAADCTVGGYDVPRGTMLLVNVHAVHRD
PAVWEDPDRFVPERFEGAGGKAEGRLLMPFGMGRRKCPGETLALRTVGLVLATLLQCFDW
DTVDGAQVDMKASGGLTMPRAVPLEAMCRPRTAMRGVLKRL*

MDKAYVAALSVAFLFLVHYLVGRAAAGGGKGRKRLPPSPLAIPFLGHLHLVKTPFHSALG
RLAERHGPVFSLRMGCRRAVVVSSPECARACFTEHDMSFANRPRFESMRLVSFDGAMLSV
SSYGPYWRTLRRVAAVQLLSAHRVACMSPVICAEVRAMVRRMARLAAGGAARVQLRRRLF
ELSLGVLMETIARTKTSRSEACAADTDVSPEASELTRISEEIMPYLGTANLWDYLPFLRW
FDVFGVRNKLMAAVRWRDAFLRRLIDAERRRMDGDGDGEKKSMIAVLLSLQKSEPELYTD
TMIMALCGDLFGAGTETTSVTTEWAMSLLLSHPEALKKAQAEIDAVVGNSRRLITADDVP
RLGYLHCVINETLRMYPAAPLLLPHESAADCKVGGYDVPRGTLLIVNAYAIHRDPAVWED
PGSFLPERFEDGKAEGRLLMPFGMGRRKCPGETLALRTVGLVLATLLQCFDWDTVDGAEV
DMTESGGLTMPRAVPLEAMCKPRAAMCDVLREL*

Other information
Ka divergence:0.141924KaKs divergence:0.0930931
GC content 1 (%):70GC content 2 (%):69GC content divergence:-0.007
Length 1 (bp):1566Length 2 (bp):1542Length divergence:-0.008
MFE 1 (kcal):-817.6MFE 2 (kcal):-800.9MFE divergence-0.01