Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G091119-GRMZM2G088231
Species:maize
Duplication type:WGD
Function (paralog1):importin alpha-1b subunit
Function (paralog2):importin alpha-1b subunit (LOC100282153), mRNA

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MSLRPSERVEVRRNRYKVAVDAEEGRRRREDNMVEIRKSRREESLLKRRREGLQAQVPAP
PSGVEKKLESLPAMVSGVYSDDNNLQLEATTQFRKLLSIERSPPIEEVIKSGVVPRFVQL
LTREDLPQLQFEAAWALTNIASGTSENTKVVIDHGAVPIFVKLLGSGSDDVREQAVWALG
NVAGDSPKCRDLVLANGALMPLLAQLNEHAKLSMLRNATWTLSNFCRGKPQPSFDQTKPA
LPALARLIHSNDEEVLTDACWALSYLSDGTNDKIQAVIEAGVCPRLVELLLHPSPSVLIP
ALRTVGNIVTGDDQQTQCIIDHQALPRLLNLLTQNHKKSIKKEACWTISNITAGNKDQIQ
AVISAGIIAPLLQLLQGAEFDIKKEAAWAISNATSGGSHEQIKYLVSEGCIVPLCDLLVC
PDPRIVTVCLEGLENILKVGEHDKTMGATGDINVFAQMIDDAEGLEKIENLQSHDNNEIY
EKAVKLLETYWMEEEDDAMATAGEAAPAVFDFSQGGNPPGGGLNLN*

MPLLAQLNEHVKLSMLRNATWTLSNFCRGKPQPSFDQTKPALPALARLIHSNDEEVLTDA
CWALSYLSDGTNDKIQAVIEAGVCPRLVELLLHPSPSVLIPALRTVGNIVTGDDLQTQCI
IDHQALPRLLNLLTQNHKKSIKKEACWTISNITAGNKDQIQAVISAGIIAPLLQLLQTAE
FDIKKEAAWAISNATSGGSHEQIKYLVSEGCIKPLCDLLVCPDPRIVTVCLEGLENILKV
GQHDKTMGATGDTNVLAQMIDEAEGLEKIENLQSHDNNEIYEKAVKLLETYWMEEEDDAM
ATAGEAAPAVFDFNQGGNPPAAGGLNFN*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):50GC content 2 (%):47GC content divergence:-0.031
Length 1 (bp):1581Length 2 (bp):987Length divergence:-0.231
MFE 1 (kcal):-545.98MFE 2 (kcal):-314.99MFE divergence-0.268