Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G091456-GRMZM2G105787
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100274333
Function (paralog2):LOC100285558

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-0.59161399737608
Log2 mRNA fold difference:0.10291701213166
Log2 TE fold difference:-0.65100465653557
Sequences
Protein sequence

MAATAAAAGVEFPLIGVAVATLIVTVLVAAVMRRRRRPWHQAPLVEGKPAPEAGCAVSDG
GTDVIIVGAGVAGSALAYTLGKVDGRRVHVIERDLTEPDRIVGELLQPGGYLKLIELGLQ
DCVEEIDAQRVLGYALFKDGRNTKLAYPLEKFHSDVAGRSFHNGRFIQRMRQKAASLPNV
QLEQGTVTSLLEENGTVKGVQYKTKSGEELKAYAPLTIVCDGCFSNLRRALCSPKVDVPS
CFVGLVLENCQLPHPNHGHVILANPSPILFYPISSTEVRCLVDVPGQKVPSIATGEMANY
LKTVVAPQIPPEIYDSFIAAIDKGSIRTMPNRSMPAAPHPTPGALLMGDAFNMRHPLTGG
GMTVALSDIVVLRNLLKPLRNLHDASSLCKYLESFYTLRKPVASTINTLAGALYKVFSAS
PDQARNEMRQACFDYLSLGGVFSNGPIALLSGLNPRPLSLVAHFFAVAIYGVGRLMLPLP
SPKRMWIGARLISGACGIILPIIKAEGVRQMFFPATVPAYYRAAPTGEKA*

MAAMAAAGGVGLHLIGAATATLIVAVLVAAVLGRRRRARARAQAPPVEGKPAPEAGCAVG
DGAGPDVGTDVIIVGAGVAGSALAYTLGKDGRRVHVIERDLTEPDRIVGELLQPGGYLKL
IELGLQDCVEEIDAQRVLGYALFKDGRNTKLAYPLEKFHSDVAGRSFHNGRFIQRMRQKA
ASLPNVQLEQGTVTSLLEENGTVKGVQYKTKSGEELKAYAPLTIVCDGCFSNLRRALCSP
KVDVPSCFIGLVLENCQLPHPNHGHVILANPSPILFYPISSTEVRCLVDVPGQKVPSIAS
GEMANYLKTVVAPQIPPEIYDSFIAAIDKGSIRTMPNRSMPAAPLPTPGALLMGDAFNMR
HPLTGGGMTVALSDIVVLRNLLKPLRNLHDASSLCKYLESFYTLRKPVASTINTLAGALY
KVFSASPDQARNEMRQACFDYLSLGGVFSNGPIALLSGLNPRPLSLVAHFFAVAIYGVGR
LMLPLPSPKRMWIGARLISGACGIILPIIKAEGVRQMFFPATVPAYYRAAPTGE*

Other information
Ka divergence:-0.309695KaKs divergence:-0.185581
GC content 1 (%):52GC content 2 (%):53GC content divergence:0.01
Length 1 (bp):1593Length 2 (bp):1605Length divergence:0.004
MFE 1 (kcal):-572.61MFE 2 (kcal):-586MFE divergence0.012