Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G091543-GRMZM2G100473
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100279890
Function (paralog2):hypothetical protein LOC100277631 (LOC100277631), mRNA

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.52341235036546
Log2 mRNA fold difference:-0.71670620509116
Log2 TE fold difference:0.38805623351328
Sequences
Protein sequence

MSTAAATKTPTKPLAAAARTPTKPQPPAVAKTPCLSRARPSHASENSNPNIPGTPPPPQS
TPSKPVLKSPPPAGARSATARKKPSTPAPPPERERRFLVAKKGARRRRNVATVGGGGGEI
DFDKCREAAREALRASQGDFFRKELAASTATGEEQLGQEAEEVKQVAEEGVEGGALEERP
EEGTDAELEGSSKVRAMRSKAMAKTVTSVPEPGSGRVKNMVQAFESLLNISERSGDGSRA
LPGLQLWKEESESNLGFPPLSVFSSADFQNAGSDRLCSSLDGNTVRLTWDSRTSAGEGRS
RRNSSESIRSRTSAGERRSRRNSSESLRSSWNKKLKVTSQHPFKLRTEQRGKFKEQQFVQ
KVQEMLVEEENKRIHIAQGLPWTTDEPECLIKPAVKERTEPVDLVLHSDVRALERAEFDQ
HVLERNKFAEQQRLEWERQQELEEEERIRQLRRTELVPKAQPMPYFDRPFIPKRSTKPAT
VPMEPKFHLRPEKISCYCRQQCMELGKLNPQQQCQHPLWQSRSTEHQHT*

METSRRPKPIHPQGGIHDPVRSSPRALLQTLAMSTAAAAKTPIKALGSAAAGAMTPTKSQ
APAAAKTPCTSRARSSHASENSNPNIPGTPPPPQSTPSKPSLKSPAGAGARSATAKKKPS
TPAPAAPPLERERERRFLVAKKGARRRRNVGTMGGGGGGRGGEIDFDKCREAAREALRAS
QGEFFRKEVAASTATGEDQLGQEEEGKPLADEDVKGGAFEERQEEETDAELEGSSKVRAM
RTKAMAKAMSSVPNPGSGRVKHMVQAFESLLNISGATSDAERAGEGSWALPGLQLWKEDD
KGDLGFPPVSVFSSADFQNAGSNRLCSSLDGNTVRSSWDSRTSTGECSRRNSSESLRSRT
SAGGRRSRRNSSESLRSSWNKKLKVTSQHPFKLRTEQRGKFKEQQFVQKVQEMLAEEEKK
RIHIAQGLPWTTDEPECLIKPAVKERTEPIDLVLHSDVRALERAEFDQHVLDRNKFAEQQ
RLEWERQQELDEEERIRQLRRTELIPKAQPMPYFDRPFIPKRSTKPPTVPMEPKFYLRPE
KLSCYYRQQCMELGKLNPQHQCQHPLWQSRNAEHRHT*

Other information
Ka divergence:-0.25202KaKs divergence:-0.275519
GC content 1 (%):58GC content 2 (%):58GC content divergence:0
Length 1 (bp):1590Length 2 (bp):1734Length divergence:0.043
MFE 1 (kcal):-635.4MFE 2 (kcal):-697.09MFE divergence0.046