Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G091563-GRMZM2G100511
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100191520
Function (paralog2):LOC100283246

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:1.3075783470918
Log2 mRNA fold difference:0.97301036939015
Log2 TE fold difference:0.33922575532559
Sequences
Protein sequence

MAFRRILSTAVRRRSAVAAAAAGNAREASTAVAAAPGVLAPDATAVRAPVMPYDRIADAV
NARLRRLEHPDPRFLRYASPVPSHADHMAILAAPETRVTTLPNGLRIATESSLAARTATV
GVWIDAGSRYENEEAVGVAHFVEHMLFKGTGKRSAAQLELEIEDMGGHLNAYTSREQTTY
YAKVLDKDVPRAMEVLSDILQNSNLDQARIEREREVILREMGEVEGQSEEVIFDHLHATA
FQYTSLGRPILGSAENVKSITKEDLENYIATHYTAPRMVITAAGNVKHEDIVEQAKKLFN
KLSTDPTTTNMLVAKQPASFTGSEVRIIDDDMPLAQFAVAFNGASWVDPDSVALMVMQSM
LGSWNKSAGGGKHMGSELVQKAAINDIAESVMSFNMNYKDTGLFGVYAVAKADCLDDLAF
AIMHEMSKLSYRVTEEDVIRARNQLKSSIQLHLDGSTAVVEDIGRQLLTYGRRIPTPELF
ARIDAVDASTVKRVANRFIFDQDVAIAAMGPIQGLPDYNWFRRRTYMLRY*

MAFRRILSTAVRRRSAIAAAAAGNAREASTAVAAAPGVLAPDATPVRAPVMPYDRIAEAV
NARLRRLEHPDPRFLRYASPVPSHADHTAILAAPETRVTTLPNGLRVATESSLAARTATV
GVWIDAGSRYENEEAAGVAHFVEHMLFKGTGKRSAAQLEQEIEDMGGHLNAYTSREQTTY
YAKVLDKDVPRAMEVLADILQNSNLDQARIEREREVILREMEEVEGQSEEVIFDHLHATA
FQYTSLGRPILGSADNVKSITKEDLENYIATHYTASRMVITAAGNVKHEDIVEQAKKLFS
KLSTDPTTTNMLVSKQPASFTGSEVRIIDDDMPLAQFAVAFNGASWVDPDSVALMVMQTM
LGSWNKSAGGGKHMGSELVQRAAINDIAESVMGFNTNYKDTGLFGVYAVAKADCLDDLAF
AIMHEMSKLSYRVTEEDVIRARNQLKSSIQLHLDGSTAVVEDIGRQLLTYGRRIPTPELF
ARIDAVDASTVKRVANRFIFDQDVAIAAMGPIQGLPDYNWFRRRTYMLRY*

www.000webhost.com

Other information
Ka divergence:-0.456224KaKs divergence:-0.439597
GC content 1 (%):55GC content 2 (%):55GC content divergence:0
Length 1 (bp):1593Length 2 (bp):1593Length divergence:0
MFE 1 (kcal):-609.57MFE 2 (kcal):-613.6MFE divergence0.003