Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G091586-GRMZM2G002828
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100193219
Function (paralog2):transcription initiation factor IIB

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MSDSFCPDCKKHTEVAFDHSAGDMVCTECGLVLEAHSVDETSEWRTFANESNDNDPVRVG
GPTNPLLTDGGLSTVIAKPNGAQGDFLSSSLGRWQNRGSNPDRSLILAFRTIANMADRLG
LVATIKDRANEIYKKVEDLKSIRGRNQDAILAACLYIACRQEDRPRTVKEICSVANGATK
KEIGRAKEFIVKQLEVEMGQSMEMGTIHAGNFLRRFCSTLGMNNQAVRAAQDAVKHSEEL
DIRRSPISIAAAVIYMITQLSEDKKPLKDISLATGVAEGTIRNSYKDLYPYASRLIPNTY
AKEEDLKNLCTP*

MSDSYCPDCKKHTEVAFDHSAGDTVCTECGLVLEAHSVDETSEWRTFANESNDNDPVRVG
GPSNPLLTDGGLSTVIAKPNGAQGDFLSSSLGRWQNRGSNPDRSLILAFRTIANMADRLG
LVATIKDRANEIFKKIEDLKSIRGRNQDAILAACLYIACRQEDRPRTVKEICSVANGATK
KEIGRAKEFIVKQLEVEMGQSMEMGTIHAGDFLRRFCSTLGMTNQAVNAAKEAVQRSEEL
DIRRSPISIAAAVIYMITQLSEDKKPLKGLECCPIVFFHVTDIQVIILENLLQIYPWLLV
WQKAPSEIRTRICIPTPQGSSRIPTPRKKT*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):52GC content 2 (%):52GC content divergence:0
Length 1 (bp):939Length 2 (bp):993Length divergence:0.028
MFE 1 (kcal):-312.1MFE 2 (kcal):-337.22MFE divergence0.039