Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G091837-GRMZM2G379563
Species:maize
Duplication type:WGD
Function (paralog1):senescence-inducible chloroplast stay-green protein 2
Function (paralog2):senescence-inducible chloroplast stay-green protein 1

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-0.13718932213656
Log2 mRNA fold difference:-0.67404953849353
Log2 TE fold difference:0.54592390912719
Sequences
Protein sequence

MAAATAAASTMSLLPISQLRQQHGAGAMRRRPWVARRRRYVVPTARLFGPAIFEASKLKV
LFLGVDDEAGSKQHGPLPRTYTLTHSDVTARLTLAVSHTINRAQLQGWYNRLQRDEVVAE
WKKVRGRMSLHVHCHISGGHFLLDLIAGLRYVIFRKELPVVLKAFVHGDGDLFSRHPELE
EATVWVYFHSNLARFNRVECWGPLRDAAAPAEDDSAAPADSSNSKDGQMMAMCEWPHRCP
QQCDCCFPPHSLIPWPNEHDMATAAAADASGSAQQQ*

MAAAASTMSLLPISQPRKQQQQGAGAVVVFQRRPWDARRRRYVVPTARLFGPAIFEASKL
KVLFLGVDEGEGSSKHLHAHHPAPAPALLPRTYTLTHSDVTASLTLAVSHTINRAQLQGW
YNRLQRDEVVAEWKKVRGRMSLHVHCHISGGHLLLDLIAGLRYYIFRKELPVVLEAFVHG
DGDLFSRHPELEEATVWVYFHSNLARFNRVECWGPLRDAAAPAPAEDDSTAPAAASIAME
GQMPVGEWPHRCPQQCDCCFPPHSLIPWPNEQDMATAAGQVRQQ*

Other information
Ka divergence:-0.0782052KaKs divergence:-0.174595
GC content 1 (%):70GC content 2 (%):70GC content divergence:0
Length 1 (bp):831Length 2 (bp):855Length divergence:0.014
MFE 1 (kcal):-415.8MFE 2 (kcal):-435.4MFE divergence0.023