Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G092107-GRMZM2G381267
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100276827
Function (paralog2):hypothetical protein LOC100277155

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:1.3110857180127
Log2 mRNA fold difference:0.71790863238404
Log2 TE fold difference:0.6035493487477
Sequences
Protein sequence

MERAVPVRKPHTSTADLLSWSATAPDASASPAASSRPSLKPAAGITPAMFGAPVTEQEAE
DLSKSERKFCSGSKLKEMSGSGIFAEKSENGDSEASNPDNKTSLRMYQQTVTGISQISFS
ADGSVSPKKPSSIPEVAKQRELSGTLEDADAKINKQLSEAKTKELSGSDIFGPPPEIPAR
PLAARNMELQGNVDFSLPQRSVHTSVKVSNPAGGPSNISFSEEPVVKTAKKIHNQKFQEL
TGNNIFKEDVPSSAEKSLSSAKLKEMSGSDIFADGTPAPREYLGGIRKPPGGESSIALI*

MTAASSPQRTPSGAASQRAHLRKSHTNTADLLSWSATGPDASASPAASSRPSLKPAAGIT
PAMFGAPVTEQEAEDLSKSERKFCSGSKLKEMGGSGIFAEKSENGDAEASNPANKTSLRM
YQQTVTGISQISFSADGSVSPKKPSSIPEVAKQRELSGTLEDADAKINKQLSEAKTKELS
GSDIFGPPPEIPARPLAARNMELQGNVDFSLPQRSVHTSVKVSNPAGGPSNISFSEEPVV
KTAKKIHNQKFQELTGNNIFKEDVPASAEKSLSSAKLKEMSGSDIFADGTPAPREYLGGI
RKPPGGESSIALI*

Other information
Ka divergence:0.585499KaKs divergence:0.635439
GC content 1 (%):54GC content 2 (%):55GC content divergence:0.009
Length 1 (bp):900Length 2 (bp):942Length divergence:0.023
MFE 1 (kcal):-329.99MFE 2 (kcal):-355.3MFE divergence0.037