Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G092409-GRMZM2G134866
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100272929
Function (paralog2):hypothetical protein LOC100277696

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0.43975709952591
Log2 mRNA fold difference:0.55607841304611
Log2 TE fold difference:-0.16939158777737
Sequences
Protein sequence

MAPKRPAAAAAAASGSASEASDAEADVGHQPSSPSPSKTPPTNPNPKSAAAGPAEDSTAA
GSDSEAAYDSDADHRPAHRKAAVAASPSRKPRSPRPRSRSRSPDAASYSDGAASDADADP
AARDGADSADDGNASPLALPRLSRAEAAAIKPLSSRPMDPPRRSMVHSFSELRSKRPRSA
AVPSSVEQLKRPTRLWSLRDEIVILRGLVTYRAKRGVLPGAMYDISMFQGHIQSELSVNV
TPTQLSDKVRRLKQKYNQLASRGKNGRDPDLPTQHEQSVYEIGKKVWGTSTGGDGYEIGG
DSQEEHEIGESDEDVESGWDERARKNRRLMPITMANGHGSGFGAGRGKFDVEKGKDAYPY
LWETVEDLSKEHPNGVAFKKAFELIEGARARGMEEKLRKFRLTEIRHQLRRMELMKETVK
MVLDALEG*

MAPKRPAAASGSASEASDAEADAGHHQPSSPSPSKTPPPPNPNPKSTAAGPTSAAEDSTA
AGSGSEAAYDSDADHRTAPRNAASPSSKPRSTRPRSRSRSRSPDAASYSDGVASDADADP
AAVDGADSADDGNASPLAPPRPSRAEAAAVKPISSRPMDPPRRSMVPSFSEQRSKRPRSV
AVPSSVEHLKRPTRLWSLHDEIVILRGLATYRAKRGVLPGSTYDISKLHGRIRSELSVKV
TTTQLGDKVRRLKQKYNLLASRGKSGRDPDLPSQHEQSVYEIGKKVWGGSANGGGSTGGD
GYEIGGDSEEEHEFRESDEDVENGRDERARKNRRVMPIAMANGNGAGLGAVKANSRGKFD
TEKGKDAYPYLWETVEDLSKEHPNGVAFKKAFESIEGPKARGMEEKLRKFRLTEIRHQLR
RMELMKETVKMVLDALEG*

Other information
Ka divergence:-0.050055KaKs divergence:-0.101844
GC content 1 (%):63GC content 2 (%):65GC content divergence:0.016
Length 1 (bp):1287Length 2 (bp):1317Length divergence:0.012
MFE 1 (kcal):-549.31MFE 2 (kcal):-573.1MFE divergence0.021