Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G092533-GRMZM2G156713
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MTSPSPLCGVSCSVTARGRGSARLPDVSRGKGMNSDEFNGQAHQNLFYDFNAVGARDVVV
VHVPEGVNVADDSVHIMFAYTNSGAEIMLMSNPRVLVVAEKAAEVAIVEEQEHFGVGEEG
GCYWANPVAEIIIDEGARVVHSYVQHQSFAAAHTKWTVVKQDATRNSIFDGNIKVNRRPL
VHVLPRPRFAPLSPAAISASPQPPFMAPSNLASRNPARQSRGALARSLRGPPKLAIPRAS
RPRRSTFHRVLGSRGNLPPPERCHPEPAPAAIVASGRRADPLSIEFQKPRPPIPSRVEAE
RFLRAVDDLCRLAPASPASVGSPRRASSAGGACTVVEVAMTRLEDEFCHVLSARALDLEI
EALSSLSSLSMASDWSNSDATEAAAGEEDDGSVSSSVGRRSSYRSLQSIREIDLFPVDAI
SDLHTKVRSARACHPSPIMRSDIILFLKEGSQLKAWWLHHCIHERMAPGPCHAFKRPSDC
HCRLFHSTSGGTISQKANKDIIHHTWYFYLFPLDYNDCPKLFFCEFFLSFMKRKELASEA
HACLQLWSLITPVNPANTWGPLIFIFAVSATKEAWDDYNRYISDKQVNAKEVWIVKNGTR
KHIQAQDIRVGNIVWIRENEEVPCDLVLLGTSEPQGICHVEGGLPPEAVYNIIIDPKNKR
VFMISKFPSEKEEMASKYCSTEQVPYEWVFALYLCASTNILSEDSIHTTWTFAASTAPPP
SHDHHSSAIPGRDDCGIELTPDGAQSPKVPHGCPPQASDQVVFLPVGCRMPSCDGEAKHR
TEGRERGEQASEKLRRYAQQTDAGQETKCLILSPKALVNVKPNLQIIADDVKCTHGAAIS
GELDPNELFLLPGKRHQHGNCNRCPVILLWSPCDKSAYRLSP*

MSSPSPLCAASCSTALRAPPPPLLRFRRSYAPVAASVPRTAPAVSDDLVLRIAEQLEDSV
TSTSPLLDPLRSASALSLLSTRWPTRRSSEAFRFTDISYLRSLPISLPSREPDLKLPSSP
FSSHVLFSDGILVSSSGAHVSALADLPPGRARDRAAAALAAAAEFAHKDLFYDFNAVGAR
DVVVVHVPEGVKVADDPIHIMFAYTNSFAESMLMSNPRVLVVAEKSAEVAIVEEHFGAGE
EGGCYWANPVAEIIIDEGARVVHSYVQHQSFAAAHTKWTVVQQDTTSKYEFVEVSTGAKL
NRHNLHIEQLGPETETELSTLHLTSQNKQIHDLHSRLILDHPRGFSRQLHKCIACGTGNS
IFDGNIKVNRYAQQTDAGQETKCLILSPKALVNVKPNLQIIADDVKCTHGAAISGELDPN
ELFYFQARGINTETATDALLYFFGAHVIKRIPFKQITEKALAQFKELLASSRQTTDEALR
S*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):54GC content 2 (%):54GC content divergence:0
Length 1 (bp):2649Length 2 (bp):1446Length divergence:-0.294
MFE 1 (kcal):-973.1MFE 2 (kcal):-493.5MFE divergence-0.327