Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G092609-GRMZM2G118870
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100272272
Function (paralog2):hypothetical protein LOC100280215

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-0.073205931244268
Log2 mRNA fold difference:-0.31589051294167
Log2 TE fold difference:0.33491438427846
Sequences
Protein sequence

MSRSPHLPPRCPPLGPQITRRDDSMFTQSCRFPSGDTFFSEPPCWLDDLLADSGKAPKLP
PLRRACSDSDAILDALSTFESPICRIEEGNQISGGEADDLLDAGEGGESGSVVEASCVYG
PNSPRQKSRLTTSESSMVNAVLENVPSNPLQYLSIDASSGMNGNVANGTADTCDAFGHPD
QDKSFKRRSGQRSRVRKLQYIAELERTVDSLQNIGADLAVRVSSLFQLHNALSMENKQLR
IQISSLQRAKLIKDGQTQALKNEAERLKRMSARRSRSATASCYDPGSFSFGADASSVSWQ
MPDMARLSLNGGSPRGSYGL*

MSRSPHLPPRCPPLGPQITRRDDGMFTQSCRFPSGDTFIGEPPCWLDDLLEDSGKAPKLP
PLRRACSDSDAILDALSTFQSPIYPIEECDLNSGGEAEDLLGGVEGDESGSVVEASCFYG
PNSPRQKSRLTTSESSMVNAVLENVPGNPLQYLTIDACSDVNGNVANVTADACDAFGHPD
QDKSFKRRSGQRSRVRKLQYIAELERTVESLQNIGADLAVRMSSLFHLHNALSMENKQLR
IHISSLQQAKLIKDGQTQALKNEAERLKQMSARHRRSRSVTSCYDLSSFGADATAVNWQM
PDMARLSLNGSSSVSPRSGYGI*

Other information
Ka divergence:-0.11599KaKs divergence:-0.0680307
GC content 1 (%):51GC content 2 (%):50GC content divergence:-0.01
Length 1 (bp):963Length 2 (bp):969Length divergence:0.003
MFE 1 (kcal):-333.7MFE 2 (kcal):-327.47MFE divergence-0.009