Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G092749-GRMZM2G147780
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100191505
Function (paralog2):hypothetical protein LOC100280417

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.66540556072093
Log2 mRNA fold difference:-0.70232961760477
Log2 TE fold difference:0.0057470987110083
Sequences
Protein sequence

MRMKTLACCRRRPQDFSIDMDQEPDRVVTYNGLETCIINSSTYDDDSGISATTGGDGCIT
TDSLDDEVSSCSSKDASGSSFTSHSLSKQEEHSLDELGTPMAIHLLPFKGKKTITYTLSA
SDIENMKEKFAKLLLGDDTSGGARGVCVALALSNGIINLSATVFGELWKLEPLCEDKKIR
WRKEMDWLLSPTTYMVELVPTKQSGADGCTFEIMTPKARSDVHVNLPALQKLDMMLIEVM
DSMIDTEFWYEESGSRADGRGKITGPRKSKKWWLPSPRVPEQGLSQFQRKRLVFQAKLVH
QILKAAKSINEQVLSHMPIPAAVMDALPKSGRASLGEDLYQAITTDYIPVEEIFVSLSLK
TEHSVLETINRLEGAVFAWNQRILEERSKRSPGRHSWSFMKDSSSEVDKMSACIERVDAL
VQLLKSRYPNLPPTFIDVLKVQYNVNGNWMQDVGHAIVEAYARVLVGVAFSILSRVAEIL
LEDDLIKKPNTPMTTLKFDLSSDVYLAGITETPPGHIRRSLMDQISMVDGRYDAVVGKKK
EVKQLRW*

MLMLRWGFVSSCLFQLLLLALRRGKRRGARRDRRRMKMKALACCRRRPQDLSIDMDQEPD
RVMTYNGLETCIINCSAYDDDSGISATTCGDGCVTADSLDDEVSSCFSKDASGSSFSSHC
LSKQEEHSLDELGTPIAIHLLPFKAKKPITYTLSASDIENMKKKFAKLLLGYDTSGGARG
VCAALALSNGIINLSATVFGELWKLEPLCEDKKIRWRKEMDWLMSPTTYIVELVPRKQSG
ADGCTFEIMTPKARSDVHVNLPALQKLDTMLIEVMDSMIDTEFWYEESGSRADGPVKITG
PRKSKKWWLPSPRVPEQGLSRFQRKRLVFQAKLVHQILKAAKSINEQVLFHMPIPAAVMD
ALPKSGRASLGEDLYQAITTEYIPIEEIFVSLSLKTEHSVLETMNQLEGAMFAWNQRILE
ERSKRSPGRHSWSFMKDSSSELDKMSACIERVDTLVQLLKARYPNLPPTFIDVLKVQYNV
DVGNAIVEAYSRVLVGVAFSILSRVAEILLEDDLVKRPNTPMASLKFDLSSDVYLAGITE
TPPGHVRRSLMDQISMVDGRFNAAVKKKGAKQLRW*

Other information
Ka divergence:0.265666KaKs divergence:0.339838
GC content 1 (%):49GC content 2 (%):49GC content divergence:0
Length 1 (bp):1644Length 2 (bp):1728Length divergence:0.025
MFE 1 (kcal):-575.78MFE 2 (kcal):-621.34MFE divergence0.038