Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G092947-GRMZM2G701688
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):hypothetical protein LOC100272971

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.73106855487875
Log2 mRNA fold difference:0.50200732109094
Log2 TE fold difference:0.19925077473241
Sequences
Protein sequence

MAMSPSNPMRKYSWWWDSHISPKNSKWLQENLTDMDSKIKVMIKIIDEDADSFARRAEMY
YKRRPELMSLLEELYRAYRALAERYDHAAGELRQAHKKMAEAFPDEFQLDFDDDLPTETV
TTETEADNRDMTPFFLSFIKAGDSKKRAKEDQDHEKLQKEISSLSQENQELKKKITSVLE
KGNMAEFEVLSLKEALAEQEAEKEAAFSQCQQSSDRLQSLKSEILHTQEEFNKLKEEMQN
GLQNLSTAEERCLLLETANQNLLLELDKLKLASKEKHDELNEKHIELEKLSISIQEEQLK
SMQAEMARLSVEKQLTQAQEKLRLMSLEKHGETSKIENIESTRVQLQKELDSIREENRKL
DDQNHSSTSVIIRLQDEIISLKNAQRRLEEEVSRHVEDKKVLQHELSHLKDSKGDMDRKH
FSIKEQIQEVNFNVESLQSLAQEVRDGNVELKETIKNHDGVKALYVDNLMLLERTLEKNA
HLERSLSAATNEIEGLQEKKSALEESCKHLHSKVNGHQSERAMFVARIEGISHTVEKLSE
KNVFLENLLSDKNTELELLRRKLKDSEESTHAFRNQNSVLRSEKRTLMREVDSINSALLS
LETQYAELEGRYLDLEQDKDKALNEVIKLRDLLRLEKEKHKEATNSDMTKFSAIQKQIGL
LLKEVHRREDQLQEEEHRIVEAQTEIFILQRCLGDMAEANADVLAQLQKQQVVCKDQEEK
VDFLSQNNQQLTEGIGSVVEVLNLDEKYESLDLMKIDVVVQLLLHEIKCLLNTISDAQDV
KQNQILEKSLVVTLLEHFGREVADLRSERSVLKQEWQAKSEELQQLQSEKHDLLKISCEL
RKEMEARNRKVDELKSEAKFLVRQLSELQESRQSLQAEIVKLIAENSSLSSKVYRSREKE
TSFDEDFSTLVDEAIRTDILGVIFRSLYEERTSQLQRLHEDFGSLHAAGNELYQEIKLMN
KKLGDLQLENNYLEKELSRTLSICDGSGTEISSGRRRAMRRDTKLLKSGRKSQEGGQNME
QRKEVDNAGLEKSNEMLRVELQKLKNELQVLKSKEQPVIDVKSCDAEITKLLASMQLATA
NASLFKEKVLELIVTCESFEISDMVQKEVLKEEITRRNSYVDELKDKLNAIEIENRRLKV
DLNGDFTLLGALQTEVDALEKQTLSLAKDCLPPSMLKKEENPLSPQLSKIAVRPSEDQNT
TKVVKDMELQKLHGTIKALQKVVSDTGVVLEQERLDFNSNLQDARKQIEMLKLKEILDSD
ASDVNYERMMKDIQLDLVHTPSRRAAASSHGRHRKKNSVAATAQSDDNKMLALWSVDRVS
SGSRRHDMDLRPPQSEAAETEKGKKRPSSEPVPVVTVKDLSVDKQEVLSRPTVMAVAATA
TTTEPHREWKKKVIDRLSSEAQRLRDLRTIVQELRAGVEASSDAELDGVKAQMAGAEGAI
AELVDANAKLLKKAEEFTSAGDGGGDVDLRSRSQRKILERVRKMSDKAGRLELELQRFQH
ALLRHEEERAARRAAKAAAASTTVQVQRRSRVQLVEYLYGRRRDSRRPKQKARGPSCCMR
AKAIDD*

MELEQIQEVNFNVESLQSLAQEVRDGNVELKETIKNHEGVKALYVDNLMLLERTLEKSAH
LERSLSAATTEIEGLRDKKAALEESCKHLHSKVNGHQSERAMFVARIEGISHTMEKLSEK
NVFLEKLLSDNNTELELLRRKLNDSEESTHTFRNQNSVLRSEKRTLMREVDSINSALLSL
ETQYAELEGRYLDLEQDKDKALNEVIKLRELLRLEKEKHKEATNSGMTQFSAIQKQIGLL
LKEVHRREDQLQEEEHKVVEAQVEIFILQRCLGDMAEAKAGVLARLQKQQVVCKDQEEKV
GFLSQNNQQLTEGIGSVVEVLNLEEKYGSLDLMKIDVVVQLLLHEIKCLLNTISDAQDVK
QNQILEKSLVVTLLEHFGREVADLRSERSVLKQEWQTKSGELLQLQSERHDLLKTSCELR
KEMEARNRKVDELKSEAKFLVRQLSELQESRQSLQAEIVKLIEENTSLSSKVYSSREKEK
SFDDDFSTLIVETVRTDILGVIFRSLHEERTSQLRCLHEDFGSLHAAGNELYQEIKLMNK
KLGDLQLENNYLEKELSRTLSICDSSGTEISSGRRRAMRRDTKLLKSGRKSQESGQNMEQ
RKEVDNAGLDKANEMLLREELQKLKNELQVLRSKEQPVIDVKSCDAEITKLLANMQLATA
NASLFKKKVLELVMTCESFEISDMVQKEVLKEEITRRNSYVDELKDKLNAIEIENRRLKV
DLNGDFTLLGALQAEVDALEKQTLSLAKDCLPPSMLKEEEKPSSPQLSKIDVRPSEDENT
TKMVKDMELQKLHGTIKALQKVVSDTGVVLEQERLDFNSNLQDARKQIEMLKLKEILDSD
ASDVNYERMMKDIQLDLVQTPSRRAAASHGRHRKKNSVAAAAQSDDKMLALWSVDRVSSG
SRWHDVDLRPPQSEAAENDKGKKRSSSEPVVTVKDLSVDKQEVLLRPIVGAVVVATGSTT
EPHREWKKKVIDRLSSEAQRLRDLRSIVQELRAGVEASSDAELDGVKAQMADAEDAIAEL
ADANAKLLKKAEEFTSAGDGCGDVDLRSRSQRKILERVRKMSEKAGRLELELQRFQHALL
RHEEERAARRAAKAAASTAVQVQRRSRVHLVEYLYGRRRDNRRPKQKARGPSCCMRAKAI
DD*

Other information
Ka divergence:0.17805KaKs divergence:0.417033
GC content 1 (%):49GC content 2 (%):52GC content divergence:0.03
Length 1 (bp):4701Length 2 (bp):3429Length divergence:-0.156
MFE 1 (kcal):-1672.14MFE 2 (kcal):-1277.15MFE divergence-0.134