Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G093032-GRMZM2G081626
Species:maize
Duplication type:WGD
Function (paralog1):LOC542609
Function (paralog2):legumain-like protease

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MVADRLRLALLLSACLCSAWARPRLEPTIRLPSERAAADDAVGTRWAVLIAGSNGYYNYR
HQADICHAYQIMKKGGLKDENIVVFMYDDIAHSPENPRPGVIINHPQGGDVYAGVPKDYT
GREVNVDNFFAVLLGNKTALRGGSGKVVDSGPNDHIFVFYSDHGGPGVLGMPTYPYLYGD
DLVDVLKKKHAAGTYKSLVFYLEACESGSIFEGLLPNDINVYATTASNAEESSWGTYCPG
EFPSPPPEYDTCLGDLYSVAWMEDSDFHNLRTESLKQQYNLVKDRTAVQDTFSYGSHVMQ
YGSLELNVKHLFSYIGTNPANDDNTFIEDNSLPSFSKAVNQRDADLVYFWQKYRKLADSS
PEKNEARKELLEVMAHRSHVDSSVELIGSLLFGSEDGPRVLKAVRAAGEPLVDDWSCLKS
TVRTFEAQCGSLAQYGMKHMRSFANICNAGILPEAVSKVAAQACTSIPSNPWSSIHKGFS
A*

MVAARLRLSLLLSVCLSSAWARPRLEPAIRLPSQRAAAADETDDGDVGTRWAVLIAGSSG
YYNYRHQADICHAYQIMKKGGLKDENIIVFMYDDIAHSPENPRPGVIINHPQGGDVYAGV
PKDYTGRDVNVDNFFAVLLGNKTALRGGSGKVVDSGPNDHIFVFYSDHGGPGVLGMPTYP
YLYGDDLVDVLKKKHAAGTYKSLVFYLEACESGSIFEGLLPNDINVYATTASNADESSWG
TYCPGEFPSPPPEYDTCLGDLYSVAWMEDSDFHNLRTESLKQQYKLVKDRTAVHDTFSYG
SHVMQYGALELNVQRLFSYIGTDPANDGNTFIEDNSLPSFSKAVNQRDADLVYFWQKYRK
LADSSHAKNEARKELLEVMAHRSHVDSSVELIGSLLFGSEDGPRVLKAVRAPGEPLVDDW
SCLKSIVRTFEARCGSLAQYGMKHMRSFANMCNAGILPEAVSKVAAQACSSIPSNPWSSI
HKGFSA*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):54GC content 2 (%):55GC content divergence:0.009
Length 1 (bp):1446Length 2 (bp):1461Length divergence:0.005
MFE 1 (kcal):-559.86MFE 2 (kcal):-560.6MFE divergence0.001