Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G093119-GRMZM2G421829
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100383357
Function (paralog2):

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.84781064203051
Log2 mRNA fold difference:0.006270135640711
Log2 TE fold difference:-0.85451331687264
Sequences
Protein sequence

MFYSQFILAKKGPLGTIWIAAHLERKLRKNQVADTDIGVSVDSIIFPDVPIALRLSSHLM
LGVVRIYSRKVNYLFHDCSEALLKIKQAFRSTAVDLPPEESTAPYHSITLPETFDLDDFE
LPEAAFQGDTDHHVSTKEQITLQDNPEKTGYSTSQFGLDERFGDASSSHIGFDLEEELIL
NKDHSIHLQSDDGIIIQGRSSVPSTDMDIDDNKSQDIIAEGYHNMDGGHSSHGKLGSLNL
NAIDLGGNSIPNWTGYNVHTPDLNDILLHNEGIAGPSASYIQPSPYTCDEPASPEFISAQ
APATPGLMEETVPSRVHESPVLSPQRKPSPSTNDETAKTDTPAAPASDFLHSATGNANDV
GAERTELGLAKHVQVESSAFWDADASGQQHTSEGLPSQGQADHLEPAADKLVNSDGIAAS
VETVTVNATIKDVPLAVNDSEPCVDGSTEPSVVENLVQINGPLIDAQGTITQIADFQHEA
QAMQQVVASNDRLNELATSEFAEPEKMLSVPDSEFNHPIDLGLITAEKGTTESDGSNIIG
SLASRKRHLEDSLPALESETTERLSSRPHGIRTNDFVPHDDDILASILVGRRTPGFTLDS
TPLPPRESSLKRRRLGSKMGTLKRKVQIDDAMVLHADTIRQQLINTEDIRRIRKKAPCTR
SEIWMIEKGSLEDDIFHEPIFSCLSEELNKLHNRTYEAIVHPAVQNMELQGQLDMPEAIT
EDSNIAGFGAATIDGPLHIPDGIQSDAMLPRANDAYGATAAFSLQVPPNNQVNGASNDFV
IGTLFQGVTGPFIGNEKEVALADRERAQVNTLYSDHFQDVPSDLHSTDANISSQDVTLDN
SGQACAHATDGMTRELTHFVHSNANIFESNEVPASEITGVEYNQGASGFPQSTEDENAVG
YNQDVSGFPRPTEDENAVDYNQDASGFSRPTEDVQDASGFPRPTEDENMVDYNQDASGFP
RPTEDVNAVGYNQDASGFARPTEDVNAVGCNQDASGFPRSMKDENAVEYNQDGSGFPRPA
ENENDVSAMGDNSGFHENNMGSLTDLDMVNDYELKESNDFGSAINGVDTDFLNYDDDDGG
DFDDANDDEPNPNEFQSLDNSGWSSRTRGVARYLKALFDDESGLERKSVAIDHLVRGKTR
KEASRMFFETLVLTTKDYISVDQPNPFDLVRIKPGSKLLMSEF*

MFYSQFILAKKGPLGTIWIAAHLERKLRKNQVADTDIGVSVENIQSCKHVPQKAKHTQDS
IIFPDVPIALRLSSHLMLGVVRIYSRKVNYLFHDCSEALLKIKQAFRSTAVDLPPEESTA
PYHSITLPETFDLDDFELPEAVFQGDTDHHVSTKEQITLQDNPEKTGYSTSQFGLDERFG
DGSSSHIGLDLEEELILNKDHSIHLESDDGIIIQGRSSVPSTDMEIDDNKSTNITAEGYS
NMDGGPSSHVKLGPLNADDLGGNSIRNWTGYNVQTPDLNDILLHNNEDIAGPSTSYYQPS
PFTCDEPASPEFISAQAPATPGLMEETVPSRVHESPVLSPQRKASPSTNDETAKADTPAA
PASDFLHSATGNASDVVGAEMTELGLAKPVQVESSVVQDSDASVQQHTSEGLPSQGQASH
LEAAADKLVGSDGIAASVDETVTVNATIEDVPLAVNDSEPCVDGSAGPSVVNLVQMDGPL
FDAQGTVLSADFQHEVQAMQQVVASNDRLNELSTSEFAEPEKMLTAPNAEFNHAIDLGQI
TAEKGTIESDGSNIIGSLTSRKRHLEYSLPALESETTKKLPSRPHVKRTNDFVPHDDDIL
ASILVGRTPGFTLDSTPLPPRESSLKRPRLGSKMGTLKRKVQIDDAMVLHADTIRQQLIN
TEDIRRIRKKAPCTRSEIWMIEKGSLEDDLFHEPIFSCLSEELNNLHNRTYETIVHPAVQ
RMELHGQLDMPETIPEYRNIAGFGSATIDGPLHIPDGIQSDAMLSGANVAYGATAAFGLQ
IPPDYQVNRASNDFVVGTQLQEVAKPFIGNEHEVAPPDREHAQVDTLYSDRFQGVPSDLQ
RSNDANVSSQDVVLDNSGQACAHAVDGMTREFNHFVHRDANLFGSTEVPASEITGVEYNQ
DASGFPRQTEDDNTVEYNQDASGFPRPTEGGNAVEYNQDVSGFPRPTEDGKTVEYNQDAS
GFPRPTEDENTVEYNQDASGFPQPTEDENTVEYNQDASGFPRPTEDENAASATGDNSGFQ
ENNTGSHMDLDMMNDYEVKECNDFGSAIHGVDTDFLNYGDDDNDDDFVDADEPNPSEFQS
LDNSGWSSRTRGVARYLKTLFDEESGLGRKSVAIDHLVRGKTRKEASRMFFETLVLTTKD
YISVDQPNPFDFVSVKPGPKLLMSEF*

Other information
Ka divergence:-0.0496386KaKs divergence:-0.0643595
GC content 1 (%):44GC content 2 (%):45GC content divergence:0.011
Length 1 (bp):3552Length 2 (bp):3501Length divergence:-0.007
MFE 1 (kcal):-1075.81MFE 2 (kcal):-1110.51MFE divergence0.016