Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G093210-GRMZM2G093246
Species:maize
Duplication type:TD
Function (paralog1):lectin-like receptor kinase 7
Function (paralog2):

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-3.3659156834329
Log2 mRNA fold difference:-3.1641634321198
Log2 TE fold difference:-0.033196723379713
Sequences
Protein sequence

MPAAALAVRVAAVLLLLARGGSGSAPGEFVLSGFASGNVTTSGAAVVTSSGLLQLTNATN
EVFGHGFYPVPLRFKDASSTPRSFSTTFVFAMVPRHDDAHGHGIAFALAPSPTVPGAVAG
KNLGLFNTSDDTGKARSGVVAVELDTAKDEEFSDINDNHVGIDVNSLVSVSSAPAAYVDA
GSLVNISLVSGEPLQAWVEYDGASMRLEVTVAPARKPRPAVPLVSSIVNLSSAVADDTYV
GFTAANGAASTSHYVLGWSFRLGDGRATDLDASKLPPVPSSKKKTSRLNLVTLSLVVVVA
LLLASVAVAALVVRHRRFAEEQEDWEIQYGPHRISYKDLHAATRGFRDAIGQGGFGRVYH
GVLQRPVNAEVAVKKVSHDSRQGLREFVSEIASMSRLRHRNLVQLLGYCRRRGELVLVYD
YMVNGSLDRHLFDAGKPALSWEQRGKIVRDVAAGLLYLHEGWEQVVVHRDIKSANVLLDA
DMNGKLSDFGLARLYDHGSNPQTTHVIGTLGYLAPEMSKTGKATTSTDVFAFGAFLLEVA
CGRRPMERDDDLDSPGLVDLVLECWKAGRIVEARDKRIGKCDEADVELVLKLGLLCSHPD
PRCRPSMRQAVQMLEGAAPVPETPPKDLASNSRLFYGYSESFDEFATMFPATSEVTSVTT
QPSSSHSTGEGQQVSSEQITNV*

MAAAVTVAVRVMVPVLLLAPAPAAAAVEFTFTGFARENVTTSGAAATSSGGLLQLTNATN
WVLGHGFYPAPLRFKDAASGAPLSFSTTFVAAILPRYLDAHGHGLAFALAPSAAGPGLAV
AGKYLGLFNTSDNAGNGTTSEVVAVELDTALDVEFDDINNNHVGVDVHTLRSVASKPAGY
VDAATGGSVDVALASGRLLQVWIEYDGATTRLEVTVSPAGVGVPRPRVPLVSCEVDLSSA
VADQTYVGFSAANGAASSSHYVLGWSFRLGGGRAPDLDLSKLPRPPPPSGGHKKATELPL
LLTLIILVVVVLLVVSAAVTVLVVWRRRRFTEEQEDWEVEYGPHRVSYKDLYAATRGFRD
VIGVGGFGVVYRGVHPRPGGVEVAVKKVSHDSRQGLREFVSEIASMSRLRHRNLVQLLGY
CRRRGELLLVYDYMVNGSLDRHLFGAGNEPTLSWEQRAKIVRDVAAGLLYLHEGWEQVVV
HRDIKASNVLLDADMNGRLSDFGLARLYDHGSESRTTRVIGTLGYLAPEMIKTGKATPSA
DVFAFGAFLLEVACGRRPMESLGNNGDPAGLVDSVLERWKTGRIKDARDPRIGMCDEDDL
ELVLKLGLLCSHPDPRCRPSMRQVVQILEGAASLPSTPPEDLGGAGGRIFGHYETFDEFV
NVFPTTFDITTVTTPSPCSPSSADRQQLISA*

Other information
Ka divergence:0.146958KaKs divergence:0.100299
GC content 1 (%):67GC content 2 (%):68GC content divergence:0.007
Length 1 (bp):2049Length 2 (bp):2076Length divergence:0.007
MFE 1 (kcal):-1006.09MFE 2 (kcal):-1057.7MFE divergence0.025