Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G093359-GRMZM2G029566
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100192910
Function (paralog2):hypothetical protein LOC100192485

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MIETPTNQTPSATTTTPRESGGGGGAMAEPGQQLLRSFVEVAAGSHFPIQNLPFGVFRRR
GSPPQAPLPPVAIGDFALDLATVADAGLFDGPALSGSPCFHQETLNMFLGMGRPAWREAR
ATLQKILSADEPVLRDNEALRNKCLIPMSDIEMVLPITVGGYTDFFCSVHHARNCGFIFR
GPQTPVNPNWFYLPIGYNGRASSIVVSGTDVIRPRGQGHPTGNSAPYFGPSQKLDFELEM
AAIVGPGNELGKPIDINDAEEHIFGLTLMNDWSARDIQAWETIPLGPFLGKSFSTTISPW
IVTLDALKPFMCEAPKQEPEPLPYLAEKNHINYDIPLEVLIKPKDQNVALIVTKTNFKHL
YWTVTQQLTHHTINGCNMRPGDIFATGTLSGPEPDSLGCLLELTWNGQKEIPVGNLTRKF
LEDGDEVILTGCCKGEGYNIGFGTCTGKVLPALP*

MAEPSQQLRSFVEVPAGSHFPIQNLPFGVFRRRGVQAQAPRPAVAIGDFALDLAAVADAG
LFDGPALSGSPCFHQETLNMFLGMGRPAWREARATLQKILSADEPVLRDNEALRNKCLVP
MSDIEMVLPITVGGYTDFFCSVHHAMNCGFIFRGPQTPVNPNWFYLPVGYNGRASSIVVS
GTNVIRPRGQGHPTGNSAPYFGPSQKLDFELEMAAIVGPGNELGKPIDINDAEEHIFGLT
LMNDWSARDIQAWETIPLGPFLGKSFSTTVSPWIVTLDALKPFMCDAPKQEPEPLPYLAE
KNHINYDIPLEAWIKPKDQNDASIVTKTNFKHLYWTLTQQLAHHTINGCNMRPGDIFATG
TLSGPEPDSLGCLLELTWNGQKEIPVGNLTRKFLEDGDEVILTGCCKGEGYNIGFGTCTG
KVLPALP*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):51GC content 2 (%):53GC content divergence:0.019
Length 1 (bp):1365Length 2 (bp):1284Length divergence:-0.031
MFE 1 (kcal):-469.12MFE 2 (kcal):-474.89MFE divergence0.006