Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G093436-GRMZM2G128658
Species:maize
Duplication type:WGD
Function (paralog1):Putative uncharacterized protein
Function (paralog2):LOC100285724

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.14606767885032
Log2 mRNA fold difference:-0.34240321106436
Log2 TE fold difference:0.48669814103358
Sequences
Protein sequence

MSEADRIRHRTAALVLHDDEVRDKPDAKANVFADLGSPVSPLRARASVATSSSSSSGSAK
SPAPSNAGMAGGRSHSGELVGECNPPRLMAHRRSGSGQLIFSGGSSRGSGGGGGDRGSTA
SSPILNALPSGNICPSGRVPATAAPPPPRSRPDVLGSGTGHYGHGSIMRGAGMAPARSSI
DSSSFLGHSSRSPASFPASSGSLQEVTRLGNEWYKKGKYGEALRHYERAVALCPESAACR
GNRAAALIGLGRLADALRECEEAVRLDPASGRGHSRVAGICLRLGMIDKARRHFTQAGHL
QQSDPTDWQKLQEVEVHLGRCTDARKIGDWKSTLREADAAIAAGADSSQLLLALRSEALL
HLHKLEEAESTLASFLKLDSALPSSLTAAELSGMLAESYVHIVRAQIDMALGRFDAAVAA
AEKARDLDPGNAEIGMVLNNVRLVAKAREQGNDLFKAAKFSDASMAYGEGLKYDPSNSVL
HCNRAACWSKLEKWEKAVDDCNEALRIQPSYTKALLRRAASYAKLERWVDCVRDYEALRK
ELPSDKEVAEALFHAQISLKATRGEDVSNMKFGGEVEIVSSVEQLRAAISSPGVSVVYFM
SAMNQQCTQITPSVNTLCTECPSVNFLKVNIDSSPMVAKAENVRIVPTFKIYKGGVKVKE
MICPSLHVLRYSVRHYSVSSS*

MSEADRIRHCTAALALHDDEVRDKPDAKANVFADLGSPVSPLRVRASVATSSSSSSGSAK
SPAPSNAGMAGGRSHSGELVGECNPPRLMAHRRSGSGQLIFTGGGSRGRGGGSGDRGSTA
SSPMLNALPTGNIFPPVRVPATAAAPPPSRSRPDVLGSGTGHYGHGSIMRGTGMAPARSS
IDSSFLGHSSRSPASFSASSGSLQEVTRLGNEWYKKGKYGEALRHYERAVALCPESAACR
GNRAAALIGLGRLADALHECEEAVRLDPVSGRAHSRVAGVCLRLGMIDKARRHFTQAGHL
QHSDPAEWHKLQEVEVHLGRCTDARKIGDWKSALREADAAIAAGADSSQLLLALRSEALL
RLHKLEEAESTLASLLKLDSALPSSLTAAKLSGMLAESYIHIVQAQVDMAFGRFDTAVAA
AEKARDLDPGNAEIGMVLNNVRLVAKAREQGNDLFKAAKFLDASIAYGEGLKYDPLNSVL
HCNRAACWSKLEKWGKAVDDCNEALRIQPNYTKALLRRAASYAKLERWVDCVRDYEVLRK
EFPSDKEVAEALFHAQIALKATRGEDVSNMKFGGEVEMVSNVEQLNAAISSPGVTVVYFM
STMNQQCTQITPSINILCTECPSVNFLKVNVNSSPMVARTENVRIVPTFKIYKGGVKVKE
MICPSLHVLRYSVRHYSVSSS*

Other information
Ka divergence:0.269428KaKs divergence:0.204272
GC content 1 (%):58GC content 2 (%):58GC content divergence:0
Length 1 (bp):2046Length 2 (bp):2046Length divergence:0
MFE 1 (kcal):-889.69MFE 2 (kcal):-885.1MFE divergence-0.003