Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G093755-GRMZM2G392791
Species:maize
Duplication type:TD
Function (paralog1):
Function (paralog2):LOC100281378

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:4.9964705827016
Log2 mRNA fold difference:0.6948287005705
Log2 TE fold difference:4.3140123357936
Sequences
Protein sequence

KVPDSYLQEPGRAEAAFAQYDVATVLKKFYSIEIDELTAPPGVEIIDFLEASPSPLPWLS
EEELGQYAEKFRKSGFTGPLNYYRMWETNWRLLAPWNEAKITVPVKFIAGDKDIGVQSFG
VEKYIKSGEFKSTVPDLEVAVIEGHHFLQQEQAERVNSEIISYLVRFTSQEASS*

MDAEAAAAEGQVRHWTADVNGISLHVAERGAADAPAVLLIHGFPELWLSWRHQMAALAAR
GFRALAPDLRGYGDSSVPTDPAAYSILHLVGDLVALLDHLQLTKVFVVGHDWGAMVAWHL
CLFRPDRVRAAVVLGIPYFPRGPRPMTDSFAKLGDGFYINQFQEPGRAERAFARYDVATV
LKKFYALKIDEMIAPPGVEIIDFLQAPSSPIPWMTDEELGRYAEKFEKTGFTGPLNYYRM
LETNWRLTAPWSGSKITVPAKFILSKNDVGLQSFGTEKYVKSGALKENVPDLEISIIEGH
HFVQQEEAGTVNSEILSFLGKFPSEGGSA*

Other information
Ka divergence:0.0921132KaKs divergence:-0.049441
GC content 1 (%):49GC content 2 (%):61GC content divergence:0.109
Length 1 (bp):525Length 2 (bp):990Length divergence:0.307
MFE 1 (kcal):-165.6MFE 2 (kcal):-388.9MFE divergence0.403