Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G093776-GRMZM2G144109
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.0059690149770227
Log2 mRNA fold difference:-0.17388470992187
Log2 TE fold difference:0.21946925164872
Sequences
Protein sequence

MGNSLACFCCAGGAAGHVAPAALPSDPAYDEGLGHSFCYVRPDKVPVPFSADDDLVADAK
AAEDATTFRAISGAALSANVSTPLSTSLLLLLPDESAASSSGFESSESFAAVPLQPVPRF
PSGPICAPAGAGAGFLSGPIERGFLSGPLDAALMSSGPLPGAATSGRMGGAVPSLRRSLS
HGGRRLRDLTRAILARTEKLQGSMDLGLGLGLGSPDGAGLQLQWAQGKAGEDRVHVVVSE
ERGWVFVGIYDGFNGPDATDFLVSHLYAAVHRELRGLLWDQRDAHPDQPTTTSTTASDHQ
DRRRRRARRSRPPRGADDDQRRWKCEWERDCSSALKPPTQRPPRGSSQNDHLAVLKALAR
ALRKTEEAYLDVADKMVGEFPELALMGSCVLAMLMKGEDMYLMNVGDSRAVLGTMDSVDV
EQVTSDGLVGDGTPLLSAVQLTSEHSTSVRQEVCRIRNEHPDDPSAISKDRVKGSLKVTR
AFGAGFLKQPKWNEALLEMFRIDYVGSSPYVTCSPSLCHRRLSTRDRFLILSSDGLYQYF
TSEEAVAQVEMFIATTPDGDPAQHLVEEVLFKAANKAGMDFHELIEIPHGDRRRYHDDHA
LAGLTKHSLMGFRTFFSSDNKSFFLQGDYGICWMPGSAPNQKRIAELLMVCKDEKRGLKL
VKGGGRRSG*

MGNSLACFCCGGGAAGRRRHVAPAALPSDPAYDEGLGHSFCYVRPDKVLVPFSADDDDLV
ADAKAAAAAEEPTTFRAISGAALSANVSTQLSTSVLLLLPDESSSAAAASSSSSGFESSE
SFAAVPLQPVPRFPSGPICAHGGGFLSGPIERGFLSGPLDAALMSGPLPCAATSARMGGG
AVPALRRSLSHGGRRLRNFTRALLARADKFQDSMDLGSAAAAACGAGSAGLQWAQGKAGE
DRVHIVVSEERGWVFVGIYDGFNGPDATDFLVSHLYAAVHRELRGLLWDQCEQEEQRDTD
PDQPMSTTASYHQDQPANGRRARRSRPPRGADDDQRRWKCEWERDCSSLKPPTQRPPRSS
SENDHLAVLKALARALRKTEEAYLDVADKMVGEFPELALMGSCVLAMLMKGEDMYLMNVG
DSRAVLGTMDSVDLEEISGGSFDGLVGDGTPLLSALQLTSEHSTSVREEVCRIRNEHPGD
PSAISKDRVKGSLKVTRAFGAGFLKQPKWNDALLEVFRIDYVGSSPYITCNPSLYHHRLS
TRDRFLILSSDGLYQYFTNEEAVAQVEMFIATTPEGDPAQHLVEEVLFRAANKAGMDFHE
LIEIPHGDRRRYHDDVSVIVISLEGRIWRSCV*

Other information
Ka divergence:-0.514342KaKs divergence:-0.275979
GC content 1 (%):66GC content 2 (%):65GC content divergence:-0.008
Length 1 (bp):2010Length 2 (bp):1899Length divergence:-0.028
MFE 1 (kcal):-945.11MFE 2 (kcal):-882.2MFE divergence-0.034