Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G093951-GRMZM2G105987
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100383182
Function (paralog2):NHL25

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-1.7588376450662
Log2 mRNA fold difference:-0.92802791093948
Log2 TE fold difference:-0.83328511938964
Sequences
Protein sequence

MADHQRIHPVDLEAGNRPTTPLVPGGSFRSDKGDPAQRANNHHQQQQQRGYVYVPGPLPP
PPRRAAPPAPPLPPPKRRGRGCCCRFLCCAVITAVVLAVLAAAAAGALYLLLDPKAPRYS
VDRLSVSTFQVDPSTLTARAGFDVAVTAANPNSRIAIQYEPGSSLGVWYQSYRLARGALP
PFYQGHRNTTVLALAMAGEVQLGGAAVAGMRDAQRTGAVPLVFRADVPVRVELGTFKLWK
VTSRVRCDLVVDRLMDVSSPIKIKASNCKFGLKL*

MADHQRIHPADLEAGNRPLMPGGSFRSDKGDPAQRAKQQQQQGYVPGALPPPPRRVAPPA
PLPPPKRRGRGCCCRLLCCAVISAAVLAVLAAAAAGALYLALDPKAPRYSVDRLSVSAFQ
VDPATLAARARFDVAVAATNPNSRIGIHYERGSSLGVWYQSYRLARGALPAFYQGHRNTT
VLALAMAGEAQLGSAAVVSGMQDAQRTGAVPLVFRADVPVRVQLGTFKLWKVTARVRCDL
VVDRLMDVTSLIKIKAGNCKFSLKL*

Other information
Ka divergence:0.228581KaKs divergence:0.0259128
GC content 1 (%):72GC content 2 (%):73GC content divergence:0.007
Length 1 (bp):825Length 2 (bp):798Length divergence:-0.017
MFE 1 (kcal):-444.81MFE 2 (kcal):-447.1MFE divergence0.003