Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G094072-GRMZM2G347322
Species:maize
Duplication type:TD
Function (paralog1):CFM2 alternative polyadenylation form 1 Fragment
Function (paralog2):

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:4.0090682350919
Log2 mRNA fold difference:0.60759462275813
Log2 TE fold difference:3.4014544882476
Sequences
Protein sequence

MLLSFSPHFSPLLISLPSTSACKPHARLRPVHASASASTSPELLGKSALRRISDKLRSLG
YLETVSEPPTPAPNKSGDAPSPGEIFVPTPAQLPRHRVGSTLDPSWATGDGEASSTSRQR
RRGRGRDASGSPSAPPSAAELALPRDELRRLQGIGIRVRKRLKVGKAGITEGIVNGIHER
WRNAEVVKLRCEDVWAMNMRRTHEILERKTGGLVIWRSGSTIILYRGTNYTYPYFHHSER
VDSFLDKESSDQSNSGDEDETSSQHGSSHEKSSENPVVACAEQIHVGEGNSQTIEYLNQS
LSREKDTNHPVSSIKRLVFDADEGNLDIRAGNPNEQHVRLQENTHPDSPNKFGPRDRSSL
VAGVGSQNKFRLQLPGEVKLAEEADKLLDGLGPRFSGWWGYDPVPVDADLLPAIVPGYRR
PFRLLPSGVPPKLTDREMTILRRLAHALPFHYALGRSSNLQGLAASMIKLWERCEVAKIA
LKRDAHNTDSELITEEVKELTGGTLLSRDKESIVFYRGKDFLPPAVSLAIEKRRKLGSST
IYKAKPGIEESMPTQNDSVLKVSSDVSVHVREEGTSVTENRAESLNTVAKDVETRLSQAI
AEKAKAEKLIEELEKASPLSKAEVRETISEDERYMLRKVGLKMKQFLLLGRRGVFDGTIE
NMHLHWKYRELVKIICKEHRLEDVEYAARTLEAESGGILVAVEKVSKGHAIIVYRGKNYK
RPSKLRPKTLLSKRDALKRSLENQRCKSLKVHVLKLSKNIDYLRDQMNSSYYHKDMHDPS
VNSVTLQQQDEEMPEVAPMSSEPEVEKWTSVEIDRALDLTKSGVPVEDMQSKVCFNKLED
DSSATAGPCLTGSSIAASSYNLIRHQNQRSSTVTSSPDGRYEGAPSKVVDAPKLDAESLS
VSPLRAAPLSNQERLVLRKQALQMKKRPVLSIGRNNAITGVAKTIKTHFKKHPLAIVNIK
NRADGTPIQQLISELEEATGSVLVSRETNKVILYRGWGAEVAQKSSRESSTDEGEKEVIS
PQLLEAIRLECGLLPADSG*

MLLSFSPHFSPLLISLPSTSACKPHARLRPVHASASASTSPELLGKSALRRISDKLRSLG
YLETVSEPPTPAPNKSGDAPSPGEIFVPTPAQLPRHRVGSTLDPSWATGDGEASSTSRQR
RRGRGRDASGSPSAPPSAAELALPRDELRRLQGIGIRVRKRLKVGKAGITEGIVNGIHER
WRNAEVVKLRCEDVWAMNMRRTHEILEV

Other information
Ka divergence:1KaKs divergence:0.999998
GC content 1 (%):50GC content 2 (%):68GC content divergence:0.153
Length 1 (bp):3120Length 2 (bp):624Length divergence:-0.667
MFE 1 (kcal):-1074.78MFE 2 (kcal):-285.5MFE divergence-0.58