Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G094074-GRMZM2G120432
Species:maize
Duplication type:TD
Function (paralog1):hypothetical protein LOC100192550
Function (paralog2):hypothetical protein LOC100192550

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:1.4553779251659
Log2 mRNA fold difference:1.6663602713043
Log2 TE fold difference:-0.23338167833574
Sequences
Protein sequence

MSRRKTREPKEENVTLGPTVREGEYVFGVAHIFASFNDTFIHITDLSGRETLVRITGGMK
VKADRDESSPYAAMLAAQDVAQRCKELGITALHIKLRATGGNKTKTPGPGAQSALRALAR
SGMKIGRIEDVTPVPTDSTRRKGGRRGRRL*

MCLQSRRKTREPKEENVTLGPTVREGEYVFGVAHIFASFNDTFIHITDLSGRETLVRITG
GMKVKADRDESSPYAAMLAAQDVAQRCKELGITALHIKLRATGGNKTKTPGPGAQSALRA
LARSGMKIGRIEDVTPVPTDSTRRKGGRRGRRL*

Other information
Ka divergence:1KaKs divergence:0.999735
GC content 1 (%):56GC content 2 (%):56GC content divergence:0
Length 1 (bp):453Length 2 (bp):462Length divergence:0.01
MFE 1 (kcal):-169.9MFE 2 (kcal):-175.5MFE divergence0.016