Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G094168-GRMZM2G093270
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100216682
Function (paralog2):hypothetical protein LOC100278906

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MAIDHESPFKELRLKNRRIMGGGGPDPEPEEEEEVATAAYAGQWPRWLQPLLSARFFAHC
RTHGDSHRSGECNMFCLDCSAAGAGAGARALCSLCLAQAHRDHHTIQIRRSSYHDVIRVS
DIQRFMDIAGVQTYVINSARVVFLNERPQQQRPGCKAASASANLCEVCARSLLDNFRFCS
LGCKVVGCSPDAAKARSWLLRPAVGGSGDGDSTSSSPLRDAQKRQSFTPPTPQPAKRRKG
IPHRAPFGSFIVEY*

MAIDHESPFKELRLKNRRIMGGGGPDPEPEEEEEEGVTAAYAERWPRWLQPLLSARFFAQ
CRTHSDSNRSGECNMFCLDCSAAGGTGTGAGALCSLCLAQHGHRDHHTIQIRRSSYHDVI
RVSDIQRFMDIAGVQTYVINSARVVFLNERPQQQKPGGGKAASSSSASANLCEVCARSLL
DNFRFCSLGCKVVGCSPDAAKARNWLLRAADGDGSTTSSSAPRNADRKLSFTPPTPQPTL
PTKRRKGIPHRAPFGSLIVEY*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):71GC content 2 (%):70GC content divergence:-0.007
Length 1 (bp):765Length 2 (bp):786Length divergence:0.014
MFE 1 (kcal):-372.86MFE 2 (kcal):-378.9MFE divergence0.008