Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G094224-GRMZM2G026015
Species:maize
Duplication type:WGD
Function (paralog1):photosystem I reaction center subunit XI
Function (paralog2):hypothetical protein LOC100383080

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MATTAYAPMASQVMKSSPVHSRPRGLSGAALTRPRPRFSVVKAAIQPEKATYQVVQPING
DPFIGSLETPVTSSPLIAWYLSNLPAYRTAVSPLLRGVEVGLAHGYLLVGPFALTGPLRN
TPVHGQAGALGAAGLVAILSVCLTMYGVASFNEGDPSTAPTLTLTGRKKEADKLQTADGW
AKFTGGFFFGGISGVLWAYFLLYVLDLPYYFK*

MATAYAPMASQVMKSSLVVHSRPRGLSGAAALTRRPGRFTVKAIQPEKATYQVVQPINGD
PFIGSLETPVTSSPLVAWYLSNLPAYRTAVSPLLRGVEVGLAHGYLLVGPFALTGPLRST
PVHGQAGALGAAGLVAILSVCLTMYGVASFNEGDPSTAPTLTLTGRKKEADKLQTADGWA
KFTGGFFFGGISGVLWAYFLLYVLDLPYFFNSGRSSSLAAWYVGGVVLVSFHSSGDQRRV
*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):69GC content 2 (%):67GC content divergence:-0.015
Length 1 (bp):639Length 2 (bp):723Length divergence:0.062
MFE 1 (kcal):-288.5MFE 2 (kcal):-324.3MFE divergence0.058