Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G094390-GRMZM2G134045
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):ADP-ribosylation factor GTPase-activating protein 3

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-2.5309275139953
Log2 mRNA fold difference:-1.8104720868533
Log2 TE fold difference:-0.72314142706138
Sequences
Protein sequence

MRINVCGCRGSTVHLHHLSSSSSPPPLPFHLLPPGDSSSSLPRRSIGPPIDRARGRRFQS
GVVSIRSGSLPVWVGAMAAMDASADKNAVFRKLRAKSDNKMCFDCNAKNPTWASVTYGVF
LCIDCSAAHRSLGVHVSFVRSTNLDSWTPEQLKMMVYGGNNRAQAFFKQHGWTDGGKIEA
KYTSRAADLYRQLLAKDVAKSSTEDGNNSWPSSPVAASQAPNQAAAFPDLKLTEVSKENV
SEKKDSEIVRSPRAPTHSFKKPIGAKKPGNKTGGLGARKLTSKPNESLYEQKPEEPAPVL
PSSVIESTTTRSKSHTSRFDYVENAPALKNGNSSEGNHMSGHVAPPMSSNFFAEFGMDSG
YQKKSTSSSSKVQIEESREARQKFSKAKSISSSQFFGDQASFEKDAQVSLQKFSGSSAIS
SADLFGHPANNSSVDLSASDLINRISFQATQDLSSLKNMAGETGKKLTSMASNIITDLQD
RIL*

MAATEASADKNAVFRKLRTKSDNKMCFDCNAKNPTWASVTYGVFLCIDCSAVHRSLGVHV
SFVRSTNLDSWTPEQLKMMVYGGNNRAQAFFKQHGWTDGGKIEAKYTSRAADLYRQLLAK
EVAKSATEDGNNSWPSSPVAASQASDQTAAFPDLKLTEVSKENVSEKEDSEIVRSPRVPT
RSIKKPIGAKKPGNKTGGLGARKLTSKPNESLYEQKPEETAPVLPSSVIASTTARSKPHT
SRFEYVENAPAPKTGSSSEGNLMSGHVAPPKSSNFFVEFGMDSGYHKKSTSSSSKVQIEE
SSEARQKFSNAKSISSSQFFGDQASFEKDTQVSLQKFSGSSAISSADLFGHPANNSSVDL
SASDLINRISFQATQDLSSLKNMAGETGKRLTSMASNIITDLQDRIL*

www.000webhost.com

Other information
Ka divergence:0.0906446KaKs divergence:-0.0687806
GC content 1 (%):49GC content 2 (%):47GC content divergence:-0.021
Length 1 (bp):1452Length 2 (bp):1224Length divergence:-0.085
MFE 1 (kcal):-473.8MFE 2 (kcal):-388.79MFE divergence-0.099