Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G094490-GRMZM2G361066
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):ATPase, coupled to transmembrane movement of substances (LOC100281534), mRNA

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-3.4632950049434
Log2 mRNA fold difference:-0.92755198362006
Log2 TE fold difference:-2.5562556360644
Sequences
Protein sequence

MEEATVMSQLGRSKDSGGGRRRQRYRIETRALSYVLPPRALLVPWSSATKGKEERLLLRG
VTCEAPPGELLAVVGPSGAGKTTLLSVLAGSADPARVVAGEVLVNGVPMDAAGFRRVSGY
VPQDDALFPALTVEESLVYSARLRLRLRGGGGGGTPSGAEHRARELMAELGLAHVAASRV
ADVSGGERRRVSIGMDLVHDPAVLLLDEPTSGLDSGSALHIVKMLRDMAAAHAKTVVLTI
HQPGFRILELIDRVVLLADGAVRHHGSLDFLQSRLIATGHAIPAHVNVLEYAMETIDSLK
PDVAVATAVTTITAATPANRQDGPRAGYANSPAAEVRILAGRFVKTVLRTPQLFAARMAQ
SVLVGAFLGSIFLGTTDLQSRLGFFAFNLTYLLTSTTEALPVFLHERRILERETSRGAYR
VSSYVASNAAVFLPFLLAAAVLYAAPVYWLVGLAREPAAFAYFALVVWLVMLTANSFVAC
LSALAPNYIVGNSIVAGLIGCFFLFSGYFVASKNIPRYWVFMHYASLFKYPFEALVVNEY
GGARGARECLASAGGAGGLCVLDGAGLLRQQGMREGMRWSNLGVMLGFVVGYRVLCFVIL
SFRCHRTGR*

MSQGGKDSGGRRRHRYRIETRALSYVLPPRARIPFPWAAARGKEERLLLRGVTCEAPPGE
LVAIVGPSGAGKTTLLSVLAGSADPARVAAGEVLVNGLPMDAAMFRRVSGHVPQDDALLP
GLTVEESLVYSARLRLRSGGTSSGAEDRARELMAELGLGHVAASRVADVSGGERRRVSIG
VELVHDPAVLLLDEPTSGLDSGSALHIVKMLRDMAAAHAKTVVLTIHQPGFRILELIDRV
VLLADGAVRHHGSLDFLHSRLVATGHALPAHVNVLEYAMETIDSLKPDVAVATAVTAITA
ASSANRDDDVAPVLTVPSSARRAGYANSPAAEARILAGRFAKTMLRTPQLFAARMAQSVL
AGAFLGSIFLGTTDLQSRLGFFAFTLTYLLSSTTEALPVFLQERRTLEREISRGAYRVSS
YVASNAGVFLPFLLAAAVLYAAPVYWLVGLAREPAAFAYFVLVVWLVMLTANSFVACLGA
LVPNYIVGNSVVAGLIGCFFLFSGYFVAGKNIPRYWVFMHYASLFKYPFEALVVNEYGGA
RGARECLASAGGAGGLCVLDGAGLLRQQGMREGMRWSNLGVMLGFVVGYRVLCFVFLSFR
CHRTWR*

Other information
Ka divergence:0.257281KaKs divergence:0.209723
GC content 1 (%):71GC content 2 (%):71GC content divergence:0
Length 1 (bp):1830Length 2 (bp):1821Length divergence:-0.002
MFE 1 (kcal):-974.33MFE 2 (kcal):-951.5MFE divergence-0.012