Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G094532-GRMZM2G107299
Species:maize
Duplication type:WGD
Function (paralog1):zein protein-body ER membrane protein
Function (paralog2):hypothetical protein LOC100272468

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-3.5248855898493
Log2 mRNA fold difference:-2.2427273299195
Log2 TE fold difference:-1.1888877981881
Sequences
Protein sequence

MGGNNDGVSGAACLKPLNGVSPTYVPSAGAGALYFLIGSGLGVVAVLHASGLAEVSGEWA
SAARWTEVSREWPSAARWAAQLAGSVGAQRLLLATSLLFLAVSVWRLARRCAAVEGRVGS
TDSAVRALHVGGVVCAVCGSKIRALKRGCRGVERTRSVDSSKPVSRSLAAEFDQEADGEE
EDNAGETSDPDDGSVQYLRRRLKEEMLLKEVALEELEKERHAAASAADEAMSKIACLRSE
KALVEREARQFQEMMQQKQMYDRQVIESLQWVIMKSGMQGWEPEAITDRALSETSEDDRD
KK*

MGSNKNGVSGAANSNAVNGASPACVPGVVCFLVGSAFGAMAVLHASWLAEVGGEWASAAR
WAARPAGSIGAHRLLVTISLLFLAASVWRLAKRSAAVEARVGSTDSNRCPDKPVSGSGSQ
SQSQADREEDDNVGETIDSEEGYVQHLRRRLKKEMKLKTDALDDLDNERSAFFLLMTKNE
YLEKGKAQVLQNQEEMIHYLENEKRLVEREAPQSQKMMQEQQKAMIESLKSMIKMSGMQP
KDSRDKK*

Other information
Ka divergence:0.695397KaKs divergence:0.415633
GC content 1 (%):65GC content 2 (%):59GC content divergence:-0.048
Length 1 (bp):909Length 2 (bp):744Length divergence:-0.1
MFE 1 (kcal):-427.1MFE 2 (kcal):-302.6MFE divergence-0.171