Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G094831-GRMZM2G133203
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100276580
Function (paralog2):hypothetical protein LOC100277872

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-1.0144486230816
Log2 mRNA fold difference:-1.3878217144109
Log2 TE fold difference:0.29121172137975
Sequences
Protein sequence

MAFPWCLSAPAAVPPVAPAPGTFGVSASVTALARVPVLAGRRRRWSTLVVCAAPDEEKIT
KRSPLDFPIEWERPKPGRRPDIFPKFSPMKTPLPHPLPADDPLDDDQEEEEEEQPPPQEE
PQEDDPDKEEPEEDDPDKPTE*

MTSPWCLSAPPAAPPMAAAPSALGVSTSASALARVPVPGSKRCRWNALVVCAAPDEEKIT
KRSPLDFPIEWERPKPGRRPDIFPKFSPMKTPLPHPLPADDPLDDDEEEEEEQAPPQEEP
QEDDPDTEEPEEDDPDKPTE*

Other information
Ka divergence:0.177968KaKs divergence:-0.321381
GC content 1 (%):61GC content 2 (%):60GC content divergence:-0.008
Length 1 (bp):426Length 2 (bp):423Length divergence:-0.004
MFE 1 (kcal):-164.5MFE 2 (kcal):-152.8MFE divergence-0.037