Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G094884-GRMZM2G387569
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):hypothetical protein LOC100193865

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-0.38434924451625
Log2 mRNA fold difference:0.86176052346622
Log2 TE fold difference:-1.2470405521414
Sequences
Protein sequence

MEKEARNHYRTRGSSRGSGGGGTAAERDLLLQWGNRKRLRCVKVQRRDVEAAATAAAEKA
AISQRRAAAAAAAAQHHPTGHTHHRVLRKSEEFAIMKLPARQRQNDRIHTVASPDRECPG
RGNNNNGVPQTYPDDKKGSSSGSEGSIWPKFEITLSNREKEEDFLVFKGSKLPQRPKKRA
KVIQRTVNFVCPGTWLCDLTLERYEVREKKVSKKRPRGLKAMHDMDSDSE*

MKEARNHYHTRGSSRGGGGTTAERDLVLQWGNRKRLRCVKVQRRDVEAAATVAAEKAAIS
QRRAAATAAQHHPDGHTHHRVFRNTEEFAIMKSPARQQQNSRIDAVASPDRECPGRGNNN
NNGGPQTCPDDKKGSSSGSEGSIWPKFAVTLSNREKEEDFLVFRGSKLPQRPKKRAKVIQ
RTVNFVCPGTWLCDLTLERYEVREKKVSKKRPRGLKAMHDLDSDSE*

www.000webhost.com

Other information
Ka divergence:0.469535KaKs divergence:0.13366
GC content 1 (%):58GC content 2 (%):58GC content divergence:0
Length 1 (bp):693Length 2 (bp):681Length divergence:-0.009
MFE 1 (kcal):-261.3MFE 2 (kcal):-255.6MFE divergence-0.011